Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "magpapabunot"

1. Bukas ay magpapabunot na ako ng ngipin.

Random Sentences

1. Ang lahat ng problema.

2.

3. Umabot umano sa isang milyon ang mga dumalo sa pista ng bayan.

4. Ako na ang bahala dito. aniya at akmang tatayo na.

5. Love na love kita palagi.

6. Sweetness can also be found in natural sweeteners, such as honey and maple syrup.

7. Ito ba ang papunta sa simbahan?

8. Kahit hindi ka magaling sa pagguhit, puwede ka pa ring matuto at mag-improve sa pagguhit.

9. L'auto-évaluation régulière et la mise à jour de ses objectifs peuvent également aider à maintenir une motivation constante.

10. Ipinagtanggol ng mga obispo ang doktrina ng purgatoryo sa kanyang homiliya.

11. Salamat ha. aniya bago ako makapasok sa kwarto.

12. Electric cars may require longer charging times than refueling a gasoline-powered car, but advances in battery technology are improving charging times.

13. Motion kan også hjælpe med at reducere risikoen for visse sygdomme, såsom type 2-diabetes, hjertesygdomme og visse former for kræft.

14. Ang ina ay si Aling Rosa at ang anak ay si Pinang.

15. May salbaheng aso ang pinsan ko.

16. ¿Puede hablar más despacio por favor?

17. The project was behind schedule, and therefore extra resources were allocated.

18. No hay mal que por bien no venga. - Every cloud has a silver lining.

19. Gusto kong matutong tumugtog ng gitara.

20. Lumiit ito at nagkaroon ng mga mahahabang paa.

21. At følge sin samvittighed kan nogle gange kræve mod og styrke.

22. Walang kagatol gatol na sinagot ni Juan ang tanong ng kanyang teacher.

23. Facebook Events feature allows users to create, share, and RSVP to events.

24. I am working on a project for work.

25. Lumuwas si Fidel ng maynila.

26. Kung walang tiyaga, walang nilaga.

27. Nous avons réservé une salle de réception pour la célébration.

28. TikTok is a social media platform that allows users to create and share short-form videos.

29. Landet er et af de førende lande i verden inden for økologisk landbrug, og det er også et af de førende lande inden for vedvarende energi

30. Lumipad palayo ang saranggola at hindi na nila nakita.

31. The store offers a variety of products to suit different needs and preferences.

32. Amazon has been involved in the development of autonomous vehicles and drone delivery technology.

33. Patients may need to follow a post-hospitalization care plan, which may include medications, rehabilitation, or lifestyle changes.

34. La falta de acceso a tierras y recursos puede ser un desafío para los agricultores en algunas regiones.

35. Scientific experiments have shown that plants can respond to stimuli and communicate with each other.

36. I admire the perseverance of those who overcome adversity.

37. Las hierbas como el jengibre y la cúrcuma tienen propiedades antiinflamatorias y antioxidantes.

38. Environmental protection is not a choice, but a responsibility that we all share to protect our planet and future generations.

39.

40. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

41. Para relajarme, suelo hacer yoga o meditación como pasatiempo.

42. Bilang ganting langit sa mga kabutihan nina Waldo at Busyang, sila ay pinagkalooban ng isang anak na pagkaganda-ganda.

43. Ang tubig-ulan ay maaaring magdulot ng pagkakatanggal ng mga katas ng lupa at kemikal, na maaaring magdulot ng polusyon sa mga ilog at lawa.

44. Cut to the chase

45. Sa isang forum ng mga mamimili, ibinahagi nila ang kanilang mga mungkahi upang mapabuti ang kalidad ng mga produkto.

46. The students are studying for their exams.

47. Kuripot daw ang mga intsik.

48. Muli niyang itinaas ang kamay.

49. Naglabanan sila upang makita kung sino ang tatagal at mananaig.

50. Der kan være aldersbegrænsninger for at deltage i gamblingaktiviteter.

Recent Searches

napatawagpulang-pulatravelermagpapabunotbahasasakyantotoongkomedormakuhangkatuwaanexhaustioninvestmagsusuottagaytayleksiyonsalbahengmagtakapoongmagsunoghulihanmangyarinapahintopamumunopasyentemaghahabinabasareorganizingvictoriamagalitpakukuluannasagutannaliligopasaherohonestotinatanongmalawakmaskarahelenaunconventionalarturomartianpisaranauntogpagpaliti-rechargealmacenarperwisyopaketeganangbumuhosindependentlypampagandashoppingbirdsmaghintayleahbumililimitedcompositorescarbonlarongracialathenakasoytsssmatarikpanosuotdipangkapepangittoreteyarimayamancoalhiningistudiedorugafeedback,popularizefuelsiempreultimatelymanuscriptsystematiskbarrocohusoanlabobatimoodpitakauncheckedchavitsinabiitakspecializedipinagbibiliexamnuonwordlongnaroonelectionbilerdragontopic,putilinemalabopalagingtvsbackcontinueincreasedgotactivityservicestechnologiesbilingaddlikelysayawanmarahaspalikurannapagisuotlibertarianbutomanilbihanpagbatikananglapistomarmagta-taxiknightpandemyabigsimbahankayemphasizedpinakamagalingpeacenagliliyablibagbotongngipingmalambothinirittemparaturanagpagupitnamnakalagayhidingtypeshinipan-hipanmakatikumbinsihincitizenmaipapamanadilawmatagumpayteknolohiyarevolutioneretarbularyotuwingdagat-dagatanreynalibrogospelpromotebanalnaliwanaganpagngiticantidadejecutaniniwannumerosaspulongkomunikasyonipinalitsigamparodinggintaga-nayonmagkaibigannakumbinsimagasawangnag-aalalangnagmamaktoladasang-ayonpagtatanongpagkaimpaktotagtuyotmakidalomaliksit-shirtpapanhiknagpatuloygagawa