Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

43 sentences found for "into"

1. "Dogs come into our lives to teach us about love and loyalty."

2. A lot of time and effort went into planning the party.

3. Additionally, be aware that not all opportunities on the internet are legitimate, so always do your own research before investing time or money into any opportunity

4. All these years, I have been blessed with experiences that have shaped me into the person I am today.

5. Amazon started as an online bookstore, but it has since expanded into other areas.

6. Amazon's Alexa virtual assistant is integrated into many of its products, including the Echo smart speaker.

7. Amazon's entry into the healthcare industry with its acquisition of PillPack has disrupted the traditional pharmacy industry.

8. Bell's telephone consisted of a transmitter, which converted sound into electrical signals, and a receiver, which converted the signals back into sound

9. Cancer can be classified into different stages and types, which determine the treatment plan and prognosis.

10. Congress is divided into two chambers: the Senate and the House of Representatives

11. Dedication is what separates those who dream from those who turn their dreams into reality.

12. Diving into unknown waters is a risky activity that should be avoided.

13. Football games are typically divided into two halves of 45 minutes each, with a short break between each half.

14. Hockey games are typically divided into three periods of 20 minutes each, with a short break between each period.

15. Holy Week begins on Palm Sunday, which marks Jesus' triumphal entry into Jerusalem and the start of the Passion narrative.

16. I love coming up with creative April Fool's jokes to play on my friends and family - it's a great way to bring a little humor into our lives.

17. It's hard to break into a new social group if you don't share any common interests - birds of the same feather flock together, after all.

18. Lazada has expanded its business into the logistics and payments sectors, with Lazada Express and Lazada Wallet.

19. Let's not make this into a big deal - it's just a storm in a teacup.

20. Market indices such as the Dow Jones Industrial Average and S&P 500 can provide insights into market trends and investor sentiment.

21. She's trying to consolidate her credit card debt into a single loan with lower interest rates.

22. Smoking is a harmful habit that involves inhaling tobacco smoke into the lungs.

23. Some people are allergic to pet dander and should take this into consideration before adopting a pet.

24. The basketball court is divided into two halves, with each team playing offense and defense alternately.

25. The beaten eggs are then poured into a heated and greased pan.

26. The Constitution divides the national government into three branches: the legislative, executive, and judicial branches

27. The football field is divided into two halves, with each team playing offense and defense alternately.

28. The hockey rink is divided into three zones, with each team playing offense and defense alternately.

29. The Incredible Hulk is a scientist who transforms into a raging green monster when he gets angry.

30. The momentum of the rocket propelled it into space.

31. The objective of football is to score goals by kicking the ball into the opposing team's net.

32. The objective of hockey is to score goals by shooting the puck into the opposing team's net.

33. The Petra archaeological site in Jordan is an extraordinary wonder carved into rock.

34. The river flows into the ocean.

35. The scientific study of astronomy has led to new insights into the origins and evolution of the universe.

36. The telephone is a device that allows people to communicate over long distances by converting sound into electrical signals and transmitting them through a network of wires or wireless connection

37. They may also serve on committees or task forces to delve deeper into specific issues and make informed decisions.

38. This can be a great way to leverage your skills and turn your passion into a full-time income

39. This can include creating a cover, designing the interior layout, and converting your manuscript into a digital format

40. TikTok has become a cultural phenomenon, with its own language and trends that have spilled over into mainstream culture.

41. Ultimately, a father is an important figure in a child's life, providing love, support, and guidance as they grow and develop into adulthood.

42. Viruses can be used as vectors to deliver genetic material into cells, which can be used to treat genetic disorders.

43. With dedication, patience, and perseverance, you can turn your manuscript into a finished book that you can be proud of

Random Sentences

1. Ang aming kaharian ay hindi kayang marating ng taong may katawang lupa.

2. Gumawa ako ng cake para kay Kit.

3. Bigyan mo muna ako ng dahilan kung baket. sabi ko.

4. Maraming tao ang nagpapanggap na bukas palad upang makuha ang gusto nila, kaya kailangan nating maging maingat.

5. Nagsmile siya, Uuwi ka ha.. uuwi ka sa akin..

6. Sa paglipas ng panahon, natutunan niyang tanggapin ang pag-iisa.

7. Einstein's work has influenced many areas of modern science, including the development of string theory and the search for a theory of everything.

8. Nahuli ang magnanakaw ng mga sibilyan at iniharap ito sa mga pulis.

9. Habang nakaluhod, dalawang kamay niyang tinutop ang pisngi.

10. En invierno, los animales suelen hibernar para protegerse del clima frío.

11. Sa araw ng pamamamanhikan, dala-dala ng pamilya ng lalaki ang mga handog para sa pamilya ng babae.

12. Sino ang puwede sa Lunes ng gabi?

13. Si John ay isang mabuting kaibigan, datapwat minsan ay napag-uusapan namin ang mga hindi magandang bagay.

14. Les enseignants peuvent utiliser diverses méthodes pédagogiques pour faciliter l'apprentissage des élèves.

15. Ang pusa ay nasa ilalim ng upuan.

16. Air susu dibalas air tuba.

17. May iba pang sinasabi ang kanyang ina ngunit hindi na niya pinakinggan.

18. Maraming daga ang nahuli ng pusa ni Leah.

19. Pasensiya na kayo, wala po akong relo.

20. The dedication of mentors and role models can positively influence and shape the lives of others.

21. Nag-usap kami kamakalawa ng tanghali.

22.

23. Limitations can be physical, mental, emotional, financial, or social.

24. Las serpientes son animales solitarios y, en su mayoría, evitan el contacto con los humanos.

25. Ang rebolusyon ang tumapos sa pananakop ng mga kastila.

26. ¡Muchas gracias!

27. Kinilig ako pero di ko pinahalata, whatever.

28. Mahina ang internet sa inyong lugar? Kung gayon, baka mas mabuting gumamit ng mobile data.

29. Isang Pinoy ang nanalo sa international singing competition.

30.

31. Omelettes are a popular choice for those following a low-carb or high-protein diet.

32. The children play in the playground.

33. Sometimes all it takes is a smile or a friendly greeting to break the ice with someone.

34. Football is also known as soccer in some countries, particularly in the United States.

35. Sa panahon ng tag-ulan, mahalaga ang mga punong-kahoy dahil nakakatulong ito sa pagpigil ng pagbaha sa mga lugar na may malalaking bundok.

36. Bumagsak ang nawalan ng panimbang na si Ogor.

37. Exercise can be tough, but remember: no pain, no gain.

38. Eksport af teknologi er en stigende del af den danske eksport.

39. Ang masasakit na salitang binitiwan nya ay lubos na nakasakit sa kanyang ina.

40. Bilang paglilinaw, ang ating proyekto ay hindi pa tapos kaya hindi pa ito maaaring ipasa.

41. For doing their workday in and day out the machines need a constant supply of energy without which they would come to a halt

42. Membuka tabir untuk umum.

43. Cuídate mucho en el camino, maneja con precaución y no te distraigas.

44. Sa tahanan, ako'y nakatulog nang matiwasay sa aking malambot na kama.

45. Hindi ako pumayag na hiramin ang aking laptop sa aking kapatid dahil baka masira ito.

46. Akin na kamay mo.

47. Twitter has a set of rules and policies to govern user behavior, including guidelines against hate speech, harassment, and misinformation.

48. Palibhasa kaaya-ayang pagmasdan ang magandang mukha ng anak nila na pinangalanan na Aya.

49. Bumalik siya sa bahay nang tulala matapos mawalan ng trabaho.

50. Ang aking Maestra ay napakabait.

Similar Words

pintoNapahintohumintonapapahinto

Recent Searches

intomakisuyopag-akyathiniritpayatkahitpaginiwanfacultytinulunganrelobohollawapaninigasculturalsementotumabiopisinateachkaawaymagka-apouulaminpetroleumtuloymaynilalazadastoremagpagupitkasiyahannakasandigothersconditioningmakainbanlagfestivalesnalulungkotpasyalanmaispresencecureddibisyonlipadcedulapambansangdalisilangsalaminnasabiinternetgenerositygandamakapaniwalapagkapunomaghahandanagigingnakikisalonakainpagpanhiktubigipinambilimalikotitinuringpaliparinsetyembrechoosebulsanahintakutannamangarawanimdatipalabaspag-aaralfredsubjectpasasaanaddresslibongkanannakakatabaparaangantingimporhappysapotsanalumusobanomumurabroadcastingmahinabayangmakaangalnag-iinomsilatabing-dagatpinilitsimbahanmangespiritualnunmagbakasyonpunonagbentatheirdilawiyomedicalsariwamabihisanpagapangbathalahinahaplostiyaksunud-sunuraninitpaamapa,nagpuntadoktorpadereventosmikaelaeconomickaramihanabapossiblecitymabangoshopeepolokayosimbahapandemyahinanaptelevisedbecomecreatingbakasyonchundagat-dagatanmedisinafacebookagadamdaminbeendentistaangelanakatalungkobinabanakitangbumahanabahalapagbahingkinauupuangubounospornag-umpisanapilitanagaw-buhayfarmpulongadditionallymaramingumitipagbibirobinawianmakapagpahinganangingisaymananahinabuosumindipinansintumatawadhiwasportsebidensyakasisadyang,kamotetungkodtaosguromalinisprodujokindlekinabukasanmapahamakmatangkadpag-uwicalidadtextpagkapanalokumainpinakinggancreatemilyongsinumanghimigsikat