Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

43 sentences found for "into"

1. "Dogs come into our lives to teach us about love and loyalty."

2. A lot of time and effort went into planning the party.

3. Additionally, be aware that not all opportunities on the internet are legitimate, so always do your own research before investing time or money into any opportunity

4. All these years, I have been blessed with experiences that have shaped me into the person I am today.

5. Amazon started as an online bookstore, but it has since expanded into other areas.

6. Amazon's Alexa virtual assistant is integrated into many of its products, including the Echo smart speaker.

7. Amazon's entry into the healthcare industry with its acquisition of PillPack has disrupted the traditional pharmacy industry.

8. Bell's telephone consisted of a transmitter, which converted sound into electrical signals, and a receiver, which converted the signals back into sound

9. Cancer can be classified into different stages and types, which determine the treatment plan and prognosis.

10. Congress is divided into two chambers: the Senate and the House of Representatives

11. Dedication is what separates those who dream from those who turn their dreams into reality.

12. Diving into unknown waters is a risky activity that should be avoided.

13. Football games are typically divided into two halves of 45 minutes each, with a short break between each half.

14. Hockey games are typically divided into three periods of 20 minutes each, with a short break between each period.

15. Holy Week begins on Palm Sunday, which marks Jesus' triumphal entry into Jerusalem and the start of the Passion narrative.

16. I love coming up with creative April Fool's jokes to play on my friends and family - it's a great way to bring a little humor into our lives.

17. It's hard to break into a new social group if you don't share any common interests - birds of the same feather flock together, after all.

18. Lazada has expanded its business into the logistics and payments sectors, with Lazada Express and Lazada Wallet.

19. Let's not make this into a big deal - it's just a storm in a teacup.

20. Market indices such as the Dow Jones Industrial Average and S&P 500 can provide insights into market trends and investor sentiment.

21. She's trying to consolidate her credit card debt into a single loan with lower interest rates.

22. Smoking is a harmful habit that involves inhaling tobacco smoke into the lungs.

23. Some people are allergic to pet dander and should take this into consideration before adopting a pet.

24. The basketball court is divided into two halves, with each team playing offense and defense alternately.

25. The beaten eggs are then poured into a heated and greased pan.

26. The Constitution divides the national government into three branches: the legislative, executive, and judicial branches

27. The football field is divided into two halves, with each team playing offense and defense alternately.

28. The hockey rink is divided into three zones, with each team playing offense and defense alternately.

29. The Incredible Hulk is a scientist who transforms into a raging green monster when he gets angry.

30. The momentum of the rocket propelled it into space.

31. The objective of football is to score goals by kicking the ball into the opposing team's net.

32. The objective of hockey is to score goals by shooting the puck into the opposing team's net.

33. The Petra archaeological site in Jordan is an extraordinary wonder carved into rock.

34. The river flows into the ocean.

35. The scientific study of astronomy has led to new insights into the origins and evolution of the universe.

36. The telephone is a device that allows people to communicate over long distances by converting sound into electrical signals and transmitting them through a network of wires or wireless connection

37. They may also serve on committees or task forces to delve deeper into specific issues and make informed decisions.

38. This can be a great way to leverage your skills and turn your passion into a full-time income

39. This can include creating a cover, designing the interior layout, and converting your manuscript into a digital format

40. TikTok has become a cultural phenomenon, with its own language and trends that have spilled over into mainstream culture.

41. Ultimately, a father is an important figure in a child's life, providing love, support, and guidance as they grow and develop into adulthood.

42. Viruses can be used as vectors to deliver genetic material into cells, which can be used to treat genetic disorders.

43. With dedication, patience, and perseverance, you can turn your manuscript into a finished book that you can be proud of

Random Sentences

1. Inirapan ko na lang siya saka tumayo.

2. Tinuruan ng lolo si Ben kung paano paliparin ang saranggola.

3. Pedeng ako na lang magsubo sa sarili ko?

4. Naku di po ganun si Maico. automatic na sagot ko.

5. Ilan ang telepono sa bahay ninyo?

6. Meskipun tantangan hidup kadang-kadang sulit, tetapi mereka juga dapat memberikan kepuasan dan kebahagiaan ketika berhasil diatasi.

7. Omelettes are a popular choice for those following a low-carb or high-protein diet.

8. High blood pressure can be managed effectively with proper medical care and self-care measures.

9. Ang paggamit ng droga ay hindi lamang nakakasira ng kalusugan ng isang tao, kundi maaari rin itong magdulot ng epekto sa buong lipunan.

10. Nasa gitna ng kanyang pagsasalita, napadungaw siya sa kanan at nakita ang isang bata na tumatawa.

11. Hinanap niya ang dalaga sa buong kagubatan ngunit hindi niya nakita.

12. Da Vinci fue un pintor, escultor, arquitecto e inventor muy famoso.

13. Napansin umano ng mga eksperto ang unti-unting pagtaas ng temperatura sa mundo.

14. Sayang, kamu tahu betapa bahagianya aku bersama kamu. (Darling, you know how happy I am with you.)

15. Kapag nagkakasama-sama ang pamilya, malakas ang kapangyarihan.

16. Dalawa ang pinsan kong babae.

17. Una mala conciencia puede llevarnos a tomar malas decisiones.

18. Ang taong may takot sa Diyos, ay hindi natatakot sa mga tao.

19. Napakahalaga ng talambuhay ni Sultan Kudarat sa pag-unlad ng Mindanao bilang isang lider.

20. Der er ingen grund til at skynde sig. Vi kan tage det roligt. (There's no need to hurry. We can take it easy.)

21. Alam mo naman na mabait si Athena, di ba?

22. Dahil dito nag-away-away ang mga mababangis na hayop at mga ibon.

23. Dedication is the driving force behind artists who spend countless hours honing their craft.

24. Ang ganda talaga nya para syang artista.

25. Las plantas suelen tener raíces, tallos, hojas y flores, cada una con una función específica.

26. Dapat tayong mag-ingat sa sobrang pangamba dahil ito ay maaaring makaapekto sa ating kalusugan.

27. Time heals all wounds.

28. Coffee shops and cafes have become popular gathering places for people to socialize and work.

29. Ang aming pagsasama bilang magkabilang kabiyak ay nagbibigay ng lakas at inspirasyon sa akin.

30. Paglingon ko, nakita kong papalapit sakin si Lory.

31. Ailments can be a source of inspiration for medical research and innovation to develop new treatments and cures.

32. Taga-Ochando, New Washington ako.

33. Hindi ito maganda na maging sobrang takot sa lahat ng bagay dahil lamang sa agam-agam.

34. Tengo dolor de garganta. (I have a sore throat.)

35. He was selected as the number one overall pick in the 2003 NBA Draft by the Cleveland Cavaliers.

36. Elektroniske apparater kan tilpasses til individuelle behov og præferencer.

37. Paborito nyang panoorin ang Baby shark sa youtube.

38. Ang mga puno ng kape ay nagbibigay ng mabangong amoy sa buong paligid.

39. Mange steder i Danmark afholdes der påskeoptog og andre offentlige begivenheder i løbet af Holy Week.

40. Ang payat at namumutla ang dalaga kaya nag-alala ang binata.

41. Ang mga kasapi ng aming angkan ay nagkakaisa sa pagtatrabaho para sa kinabukasan ng pamilya.

42. Eine klare Gewissensentscheidung kann uns helfen, uns selbst treu zu bleiben.

43. Ang saya saya niya ngayon, diba?

44. Umiling ako, Wala naman. Akala ko kasi kakilala mo sya,

45.

46. Wag mo nga akong lokohin. Sige na.

47. We have been cleaning the house for three hours.

48. Eh ayoko nga eh, sundae lang talaga gusto ko.

49. Naisip niya na mas maganda kung nag-iisa siya sa bukid.

50. The celebration of Christmas has become a secular holiday in many cultures, with non-religious customs and traditions also associated with the holiday.

Similar Words

pintoNapahintohumintonapapahinto

Recent Searches

intohelpfulsedentarynameunonilutoenchanteddaanpangulomarso2001armedcomputerepowerstalelimitpeterresourcespossibleibabaimagingpinapagulongkapilingprogramaexampleprogressmemorybilhanmakapilinggitanasaffectneedswaiteditlasingactorviewtechnologicalwhichnicenegativepointwouldstreamingechavenandayaaktibistaexhaustionnag-umpisaedit:sinunodadditionkatagalegislationnakahigangenfermedades,lagaslasalamniyonipagpalitsinasabipacienciacoloramendmentsnasuklamkumapitnaglakadtilgangmaabutanpakukuluanpagbabayadmagbaliknapalitangmalungkotrightsdiliginawitannationaljosephlipattutoringtutorialsditotooitakinalagaanligayamaghapongpaparusahanmaghahatidnapapatungoinvestingmaisusuotkabundukanpatakbongbanaliyonsumakaylungsodhitipinikitwindowformspangungutyasino-sinopanghihiyangmuligumagamitumaapawgulangpakibigayeitherpaghangaumiibignilanginterestsopomagitingumilingmansanasadaptabilitycountlesscollectionsstatingdidingnapagodkinapanayammagbayadpokerlilimkahaponnagnakawcruzharapanhampaslupanakangisimangkukulampagtataasmasaksihanmabagalgarbansosinstrumentalalaalalaamangligaligtaga-hiroshimareynapantheonjennymahihirapsitawmaliitmayroongnasabotanteknightconsistnakakatandaexpeditedmarietomorrowdisciplinsirabayangpalitannangingitngitbibilhinpagpalitsasapakinunconstitutionalmalalakikalarolumiitgagamittog,nabasarestaurantbinabaratasahanunossahodkumainbinawianpagsidlangroceryitinaassampunglistahanmangingibiglayawsinakopamericanraciallarangantasatagaroonsobraasulkaraokedisposal