Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

13 sentences found for "platforms"

1. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

2. Facebook has billions of active users worldwide, making it one of the largest social media platforms.

3. Investing in stocks or cryptocurrency: You can invest in stocks or cryptocurrency through online platforms like Robinhood or Coinbase

4. Lazada is one of the largest e-commerce platforms in Southeast Asia, with millions of customers and sellers.

5. Online learning platforms have further expanded access to education, allowing people to take classes and earn degrees from anywhere in the world

6. Peer-to-peer lending: You can lend money to individuals or small businesses through online platforms like Lending Club or Prosper

7. Platforms like Upwork and Fiverr make it easy to find clients and get paid for your work

8. Platforms like YouTube, TikTok, and Twitch make it easy to share your content and reach a large audience

9. Platforms like Zoom and Skype make it easy to connect with students or clients and provide your services

10. Real estate investing: Invest in real estate through online platforms like Fundrise or Roofstock

11. Sa panahon ng pandemya, yumabong ang paggamit ng mga online platforms para sa mga transaksiyon.

12. She has a strong social media presence, boasting millions of followers on platforms like Instagram and Twitter.

13. The Lakers have a strong social media presence and engage with fans through various platforms, keeping them connected and involved.

Random Sentences

1. Eine Inflation kann die Verbraucher dazu veranlassen, Waren und Dienstleistungen zu kaufen, bevor die Preise weiter steigen.

2. No te preocupes, estaré bien, cuídate mucho y disfruta de tus vacaciones.

3. At leve i overensstemmelse med vores personlige overbevisninger og værdier kan styrke vores samvittighed.

4. Nasa sala ang telebisyon namin.

5. Hindi ako mahilig kumain ng pulotgata dahil sa sobrang tamis nito.

6. Tanging edukasyon lamang ang pag-asa nating mahihirap.

7. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

8. Nahintakutan ang lahat at hindi magawang lumaban sa magbabagsik na tulisang-dagat.

9. Owning a pet can provide a sense of purpose and joy to people of all ages.

10. The early bird catches the worm.

11. Sadyang masarap ang lutong ng tinapay na ito.

12. They are not singing a song.

13. Sa mga nakalipas na taon, yumabong ang mga organisasyon na tumutulong sa mga nangangailangan.

14. Dapat kong bilhan ng regalo si Maria.

15. Para relajarme, suelo hacer yoga o meditación como pasatiempo.

16. Aray! Bakit mo ako sinapak! Potaena mo naman!

17. He was warned not to burn bridges with his current company before accepting a new job offer.

18. His speech emphasized the importance of being charitable in thought and action.

19. Aba, kangina ba namang pumapasok ako sa palengke, e banggain ako, sabi niya.

20. Mahalaga ang pag-aaral sa talambuhay ni Teresa Magbanua upang maipakita ang papel ng kababaihan sa himagsikan.

21. Bukod tanging ang buto ng kasoy ang lungkut na lungkot.

22. Jeg har opnået stor erfaring gennem mit arbejde med at lede projekter.

23. May tatlong telepono sa bahay namin.

24. I have started a new hobby.

25. Hindi mo alam ang sagot sa tanong? Kung gayon, dapat kang mag-aral pa.

26. Mainit sa Pilipinas sa buwan ng Abril.

27. She is not drawing a picture at this moment.

28. Sa mga sitwasyon ng buhay, ang mailap na oportunidad ay kailangan mabilis na kinukuha.

29. Taga-Ochando, New Washington ako.

30. Miss, nakalabas na ba yung pasiyente dito?

31. They have studied English for five years.

32. Ang talento ng mga Pinoy sa pagkanta ay hinahangaan sa buong mundo.

33. Magkaiba man tayo ng landas ay tiyak kong magkikita pa din tayo.

34. Mathematics has a long history and has contributed to many important discoveries and inventions.

35. Ganid na sa pera ang mga taong nakaupo sa pwesto.

36. Une alimentation équilibrée et une activité physique régulière sont des éléments clés pour maintenir une bonne santé.

37. Les personnes âgées peuvent être sujettes à des chutes et d'autres accidents.

38. Sa mga tunog ng kundiman, nabibigyang-buhay ang mga kuwentong umiikot sa pag-ibig at pagdurusa.

39. Don't worry about making it perfect at this stage - just get your ideas down on paper

40. Waring may kakaibang nararamdaman siya, ngunit hindi niya ito maipaliwanag.

41. ¿Quieres que le agregue un poco de picante a tu comida?

42. Mabuti pa makatayo na at makapaghilamos na.

43. Tantangan hidup dapat muncul dalam berbagai bentuk, baik dalam bidang pribadi, profesional, atau emosional.

44. Besides, for no fault of their own even persons who are liable to inhale cigarette smoke when in the company of a smoker may suffer from any of these diseases

45. A wedding is a ceremony in which two people are united in marriage.

46. Sa kasal, karaniwang nagmula ang mga panalangin upang hilingin ang magandang buhay para sa mag-asawa.

47. The dancers are not rehearsing for their performance tonight.

48. Pinapairal ko ang aking positibong pananaw sa buhay upang hindi ako magkaroon ng agam-agam.

49. Los héroes son modelos a seguir para las generaciones futuras.

50. She does not procrastinate her work.

Recent Searches

platformsbeybladeeventsanumanbayawaktumibaymaglalabafriendmalilimutanbinawitonghjemstedmakipagtaloexportnakabaonendeligsiopaokilalastatesinilingsino-sinonaroonayokolandbrug,babalikkabiyaktransportmidleriikutanvetomapag-asangreachingmagandanginhalehihigitmagbabayadmisteryonapakasipagbutipaki-basakatipunansakalinglagnatinisintroducemadurasgracepinyalibertyentrancecynthiamagkaibabotongsubjectnagkaganitoinalalayannaglaonpracticeshumihingalnoobagyongmalapadmasasalubongipinikitvivalabisnasuklamipanlinissponsorships,diagnoseskanlurannaguguluhankommunikereroftenpasosnangangambangpresentationpuwedebinibiyayaanpagkakilalaheartgrupopabalingatlaskendiadvertising,abonopakikipagtagpopagbabagoiloiloloskonsentrasyonmatamanproducts:hawakaudiencemacadamiaumiibigrefersikinabubuhaytignancoughingcompostelapersistent,edit:fallagayunmannakaupoaparadornaabutanpaninigasteacherheartbreakmukamauntogpagtinginkontrakubyertosbilihinspeediniibigcrecermamamanhikantmicasapilitangcleanpagbabayadviewskawalanpadremanilbihanpaksawordschickenpoxsuccessthreekulisapso-callednaghihirapjuegosjoshuasafebinilinguugud-ugoddugoriyannamulaklaknangangalogincreasesreguleringnagliwanagtiniklingnapatawagfarmalleltoyouthjobsellatumatawagconstitutionpresleyantibioticsipinabalikhampasnangbiocombustibleswashingtonshowspublishing,mamataandietstructurenabigkashiningiislandaywancurtainscolorkare-karetomorrowmaninirahandisappointjobvirksomheder,makikitulogprimerkuwebanakikini-kinitadyosapalagaylasingibinalitanghinilaumiwaskahusayancommunicationsmantikajulietlaternam