Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

8 sentences found for "days"

1. From its early days as a technology for the elite, to its current status as a staple in most

2. He has been hiking in the mountains for two days.

3. He was hospitalized for pneumonia and was on a ventilator for several days.

4. Hospitalization can range from a few hours to several days or weeks, depending on the nature and severity of the condition.

5. In the early days, telephones were connected to a central switchboard, which connected calls manually

6. James A. Garfield, the twentieth president of the United States, served for only 200 days in 1881 before his assassination.

7. She missed several days of work due to pneumonia and needed to rest at home.

8. William Henry Harrison, the ninth president of the United States, served for only 31 days in 1841 before his death.

Random Sentences

1. I know things are difficult right now, but hang in there - it will get better.

2. The company’s momentum slowed down due to a decrease in sales.

3. Isang linggo nang makati ho ang balat ko.

4. Ang ganda ng swimming pool!

5. Hindi na maganda ang asal ng bata ayon sa diyosa.

6. Hun er min store forelskelse. (She's my big crush.)

7. The company introduced a new line of lightweight laptops aimed at students and professionals on the go.

8. Ang nakita niya'y pangingimi.

9. Sa kultura ng mga Igorot, mahalaga ang punong-kahoy dahil ito ang ginagamit sa kanilang mga ritwal.

10. Mi sueño es tener una familia feliz y saludable. (My dream is to have a happy and healthy family.)

11. Ang saya saya niya ngayon, diba?

12. Nag-uumigting ang kanyang mga ugat

13. Mahalaga sa aming angkan ang pagpapakita ng respeto sa nakatatanda.

14. The Lakers have had periods of dominance, including the "Showtime" era in the 1980s, when they were known for their fast-paced and entertaining style of play.

15. Makikiraan po!

16. Tila nagiging mas mahirap ang hamon habang tumatagal.

17. Dahan-dahan niyang sinalat ang baso upang hindi ito mabasag.

18. Einstein developed the theory of special relativity while working as a patent clerk in Bern, Switzerland.

19. Leonardo da Vinci diseñó varios inventos como el helicóptero y la bicicleta.

20. Tumagal ng tatlong oras ang kanyang operasyon.

21. Saan kami kumakain ng mami at siopao?

22. Bias and ethical considerations are also important factors to consider when developing and deploying AI algorithms.

23.

24. Naka color green ako na damit tapos naka shades.

25. But as in all things, too much televiewing may prove harmful. In many cases, the habit of watching TV has an adverse effect on the study habits of the young.

26. Muchas personas luchan con la adicción a las drogas y necesitan ayuda para superarla.

27. Sweetness can be enjoyed in moderation as part of a balanced and healthy diet.

28. Nakaramdam na lang ako biglang may humampas ng ulo ko.

29. Lügen haben kurze Beine.

30. May ngiti ng kasiyahang naglalaro sa maninipis na labi ni Aling Marta nang ipihit niya ang kanyang mga paa patungong pamilihan.

31. La tos crónica puede ser un síntoma de enfermedades como la bronquitis crónica y la enfermedad pulmonar obstructiva crónica (EPOC).

32. Es importante que los gobiernos tomen medidas para ayudar a las personas pobres.

33. La agricultura sostenible es una práctica importante para preservar la tierra y el medio ambiente.

34. Pumitas siya ng bunga at pinisil ito hanggang sa lumabas ang laman.

35. Malakas ang narinig niyang tawanan.

36. She studies hard for her exams.

37. Andre helte er kendt for deres humanitære arbejde.

38. Bruce Lee was a martial artist, actor, and philosopher who is widely considered to be one of the most influential figures in the history of martial arts

39. Nice meeting you po. nag smile sila tapos nag bow.

40. Walang ilog ang hindi puno ng isda.

41. They offer interest-free credit for the first six months.

42. Landet er hjemsted for en række store virksomheder, der eksporterer til hele verden

43. Matitigas at maliliit na buto.

44. ¿Cuándo es tu cumpleaños?

45. Magkasingganda ang rosas at ang orkidyas.

46. LeBron's impact extends beyond basketball, as he has become a cultural icon and one of the most recognizable athletes in the world.

47. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

48. Mula nuon, sa gubat namuhay ang mga matsing.

49. While baby fever can be a powerful and overwhelming experience, it is a natural part of the human desire to create and nurture life.

50. Binili ko ang bulaklak para kay Ida.

Recent Searches

talagapaglulutoyataagiladaysmahawaanhetosundalodangeroustilipacereadingbanggainbumabanapapalibutanngitinagbakasyonpagkasabihverdalandanpinaulanankapamilyakahariandiyanmahiwagangnakakatandapakinabangandailyphilippinecondopigilanfiaalikabukinnakatinginnagsmilenatatawanakakaanimhinampasnakamurakaninumanpinapasayakuwentoteknologipoliticalcultivotaxirestaurantsocialesproductividadfriendtreshitadealmabibingicultivateddistanciaisinuotaffiliatelibertyhumalakhakiloilonakatirakinagalitanalaknakakabangonnakatapatvitaminbuwenastinikmannearnakabawikinapagsusulitnag-oorasyonmeriendaadgangumiinomganakommunikererkalabanpagkagisingpakpaklawsagostosaidlandoambisyosangbulongnakakatulonglaranganiwinasiwasnataposanitumahanmedikalibinilimagkasamaomelettemahabolmantikanatitiyakbagaltumalimfavormaghahandahoygapenchantednapaluhaasignaturatrainingshinesbumababanyanuwakmawalakalalakihantignannatitirasapilitangeventskahuluganmag-isapogikagipitanmorenaguusaphamakrestawranpedepasahestopbetweennanonoodmagitingpagtutolpagkainisunattendedpagbebentanapagodbabapyestasagingoperahannapipilitantenernariningjackypagpanhiknagpalutosabogelvisnooutilizanmauntogprogramsfeedbacksatisfactionrevolutionizednagsuotstrategiesgamotmasaraplegendmaayosmainstreamyeahtumalabitinuringandoynagkapilatmasungitbinigyanprogramming,adventnagdaosbranchidea:effectnagkakatipun-tiponwifiprimeroutlineaaisshpowerstungkodmagdaraosbankmoviesbestfrienddeterminasyonnagsisilbinoongpronounaanhinsummitjunjunedukasyonbilangin