Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

8 sentences found for "days"

1. From its early days as a technology for the elite, to its current status as a staple in most

2. He has been hiking in the mountains for two days.

3. He was hospitalized for pneumonia and was on a ventilator for several days.

4. Hospitalization can range from a few hours to several days or weeks, depending on the nature and severity of the condition.

5. In the early days, telephones were connected to a central switchboard, which connected calls manually

6. James A. Garfield, the twentieth president of the United States, served for only 200 days in 1881 before his assassination.

7. She missed several days of work due to pneumonia and needed to rest at home.

8. William Henry Harrison, the ninth president of the United States, served for only 31 days in 1841 before his death.

Random Sentences

1. Puwede makita ang schedule ng biyahe ng bus?

2. Hindi niya tinapos ang kanyang proyekto sa tamang oras, samakatuwid, hindi siya nakasali sa kompetisyon.

3. His death was a shock to the world, and millions of fans mourned the loss of one of the most important figures in the history of American music

4.

5. Naglakad ang mga sundalo sa kalsada nang limahan.

6. Einstein's famous equation, E=mc², describes the equivalence of mass and energy.

7. Twinkle, twinkle, little star.

8. Hindi dapat basta-basta magpautang ng pera dahil ito ay maaaring magdulot ng problema sa kahuli-hulihan.

9. Gusto ko ng mas malaki pa rito.

10. Museum Nasional di Jakarta adalah museum terbesar di Indonesia yang menampilkan berbagai koleksi sejarah dan budaya Indonesia.

11.

12. Mi amigo de la infancia vive ahora en otro país y lo extraño mucho.

13. Ang magsasaka ay nagtatanim ng palay sa bukid.

14. Diversification is a strategy that involves spreading investments across multiple asset classes to reduce risk.

15. Nogle lande og jurisdiktioner har lovgivning, der regulerer gambling for at beskytte spillerne og modvirke kriminalitet.

16. Frustration can also be a symptom of underlying mental health issues such as anxiety or depression.

17. I'm going through a lot of stress at work, but I'm just trying to hang in there.

18. Madalas kami kumain sa labas.

19. Abraham Lincoln, the sixteenth president of the United States, served from 1861 to 1865 and led the country through the Civil War, ultimately preserving the Union and ending slavery.

20. If you're hoping to get promoted without working hard, you're barking up the wrong tree.

21. Pinoy ang nag-imbento ng jeepney na tinatawag ding “Hari ng Kalsada.”

22. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

23. Parang tumigil ang lahat, sumabog na ang mga fireworks...

24. Alice falls down a rabbit hole and enters a whimsical world in Alice in Wonderland.

25. Besides, smoking cigarettes means a waste of money, since the habit instead of doing any good only causes injury to one’s health and makes one a slave to the addiction

26. Cuídate mucho en el camino, maneja con precaución y no te distraigas.

27. Sa aming mga paglalakbay, nakakita kami ng mga kapatagan na mayabong na mga pastulan.

28. Environmental protection is essential for the health and well-being of the planet and its inhabitants.

29. Sadyang nagulat ako sa kanyang biglaang pagbisita.

30. Pahiram ng iyong sasakyan, wala akong ibang masasakyan pauwi.

31. Ang kanilang pagmamahalan ay animo'y walang hangganan, kahit sa anong pagsubok na dumaan.

32. Isang araw ay umuwi si Ana sa kaniyang magulang niya.

33. Børn med særlige behov har brug for ekstra støtte og ressourcer for at trives.

34. Ang gobyerno ay naglaan ng tulong para sa mga apektado ng tagtuyot.

35. When we forgive, we break the cycle of resentment and anger, creating space for love, compassion, and personal growth.

36. Bumili ako ng sarong. Ikaw, saan ka nagpunta?

37. Te agradezco por estar siempre ahí para mí.

38. Pinagsisihan niya ang mga desisyon na hinugot niya mula sa kanyang emosyon.

39. Nangangako akong pakakasalan kita.

40. Kalaro ni Pedro sa tennis si Jose.

41. They are not cooking together tonight.

42. La pobreza extrema puede llevar a la inseguridad alimentaria y la desnutrición.

43. Ang kaniyang pamilya ay disente.

44. Ang pakikinig sa mga paborito kong kanta ay isang nakagagamot na paraan upang maibsan ang aking mga problema.

45. Siya ho at wala nang iba.

46. Ow, sorry nagising ata kita. aniya.

47. Patients and their families may need to coordinate with healthcare providers, insurance companies, and other organizations during hospitalization.

48. Investment returns are subject to taxes, and investors should consider the tax implications of their investments.

49. He was also a philosopher, and his ideas on martial arts, personal development, and the human condition continue to be studied and admired today

50. Nahigitan na nito ang kakayanan ng kanyang ama at ina.

Recent Searches

dayssagingipihitaudiencepopulationexcusemakuhangmuchosricanagtalagasocialpag-uwiearlyulonapasigawpinapanoodkumikilosikinakagalitpagsalakaybroughtkalayaanvidtstraktmagpaliwanagaseansarisaringkasangkapannakikitangpalamutipakistanalas-dospinalayaspaldamagagalingkampanamahabangkutodshoppinganghelnakabiladpatiencewordsmanghulipingganlistahancupidsinekapepansittapat1940ellauripakanta-kantafatheftyitaasreservedtenbirodolyarsatisfactionloribelievedbugtonginalalayandaangtvsdoonspeechshareabsoverviewpagkikitaitssulinganchambersbubonggraduallyformprogramslimitgeneratedmessagegitanasevolveinteractsimulafrogstyrermakainkenjinamulaklakculpritnakapagsasakaysocialecomputere,cuentaautomaticgawingkalikasanangkanmasayahinriyanbusmahabanapuyatpapuntaartskutsaritangpayatsumugodsellingboboginaganapkulotnagtatrabahopamburaconvey,inspirationkagabierlindanayonhinampasalikabukinberegningerpagkaangatmanuksonakapigilanmagkaibangabstainingmabutingteknolohiyanagtitinginaniikutanwalang-tiyakbumotobansangmaalikaboknaglaonrepublicanpinakainlaylaymasasayanathan18thdiinpaosdahan-dahancondolumakipaghihingalotraininginuminnawalangmagpagalingbumisitanapakagagandanakatiramamanhikannagpaiyaknagsisigawnakaka-inmagkaibigannakapangasawamagkakagustoikinamataynagliliwanagnakakadalawdireksyonilalagaypagkabiglanananalongsulyapbayawakihahatidtatayodiscipliner,paghusayancrucialsiniyasatselebrasyonnagreklamomakapalstorypamasahesamantalangnapakagandasenadorpaglalabamagdamaganpinagawaseguridadlandlinediferentesmagbabalanaiiniscombatirlas,incrediblenagbago