Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

23 sentences found for "real"

1. Algunas serpientes, como la cobra real y la serpiente de cascabel, son conocidas por sus capacidades defensivas y sus venenos letales.

2. But there is a real fear that the world’s reserves for energy sources of petroleum, coal, and hydel power are gradually being exhausted

3. Facebook Live enables users to broadcast live videos to their followers and engage in real-time interactions.

4. Foreclosed properties are often sold at a discounted price, making them an attractive option for real estate investors.

5. Foreclosed properties may be sold through real estate agents or brokers, who can help buyers navigate the purchase process.

6. Grande married Dalton Gomez, a real estate agent, in May 2021 in a private ceremony.

7. I fell for an April Fool's joke on social media this year - a friend posted a fake news article that was so convincing I thought it was real.

8. Instagram also supports live streaming, enabling users to broadcast and engage with their audience in real-time.

9. Investors can invest in a variety of asset classes, such as stocks, bonds, real estate, and commodities.

10. Las noticias en línea pueden ser actualizadas en tiempo real.

11. Lazada has launched a live streaming feature that allows sellers to showcase their products and interact with customers in real-time.

12. Limitations can be perceived or real, and they can vary from person to person.

13. Mathematics can be used to model real-world situations and make predictions.

14. Microscopes can be used to study living organisms in real-time, allowing researchers to observe biological processes as they occur.

15. Pinocchio is a wooden puppet who dreams of becoming a real boy and learns the importance of honesty.

16. Real estate investing: Invest in real estate through online platforms like Fundrise or Roofstock

17. Stocks and bonds are generally more liquid than real estate or other alternative investments.

18. The acquired assets included a portfolio of real estate properties.

19. The author was trying to keep their identity a secret, but someone let the cat out of the bag and revealed their real name.

20. The charity made a hefty donation to the cause, helping to make a real difference in people's lives.

21. The Velveteen Rabbit is a heartwarming story about a stuffed toy who becomes real through the love of a child.

22. Trump was known for his background in real estate and his role as a television personality on the show "The Apprentice."

23. Twitter has millions of active users worldwide, making it a powerful tool for real-time news, information, and social networking.

Random Sentences

1. "Malapit nang dumating ang bagyo, maghanda na kayo," ani ng weatherman sa telebisyon.

2. Twinkle, twinkle, little star.

3. Pupunta kami sa Cebu sa Sabado.

4. Pumitas siya ng bunga at pinisil ito hanggang sa lumabas ang laman.

5. Ang Ibong Adarna ay may tatlong kapatid na naghahangad na maagaw ang mahiwagang ibon para magamit sa kanilang sariling kaharian.

6. Nandito ako sa mall. Trip lang, ayoko pang umuwi eh.

7. Kehidupan penuh dengan tantangan yang harus dihadapi setiap orang.

8. Maririnig mo ang kanyang halinghing kapag sumasakay ng bisikleta sa mababang gear.

9. Gusto kong bumili ng bestida.

10. Kasingtigas ng loob ni Sultan Barabas.

11. Many celebrities and public figures have joined TikTok to connect with their fans in a more personal way.

12. The basketball court is divided into two halves, with each team playing offense and defense alternately.

13. Omelettes are a popular choice for those following a low-carb or high-protein diet.

14. Risk tolerance is an important factor to consider when deciding how to invest.

15. Eating fresh, unprocessed foods can help reduce the risk of heart disease and diabetes.

16. Ang lamig ng yelo.

17. Maaari mo ng bitawan ang girlfriend ko, alam mo yun?

18. Påskelørdag er dagen, hvor Jesus lå i graven, og der afholdes ofte en stille og reflekterende gudstjeneste.

19. Paano mo pinalambot ang giniling na karne?

20. It is one of the most important inventions in human history, as it has revolutionized the way we communicate and has played a crucial role in shaping modern society

21. Napakalamig sa Tagaytay.

22. Ngunit sa lahat, siya ang may pinakalutang na kagandahan.

23. Nous avons prévu une lune de miel en Italie.

24. Ang kanyang mga salita ay nagbabaga ng inspirasyon sa mga nakikinig.

25. Ang paglabas sa kalikasan at pagmamasid sa magandang tanawin ay nagpapalakas sa aking loob at nagbibigay ng isang matiwasay na kalagayan.

26. Les travailleurs doivent respecter les heures de travail et les échéances.

27. Igigiit nito na ang matanda ay nandaya at baka ipinalit lamang ang isang nagawa nang tela sa ginagawa nito.

28. The invention of the telephone led to the creation of the first radio dramas and comedies

29. The United States has a history of social and political movements, including the Civil Rights Movement and the Women's Rights Movement.

30. Up above the world so high,

31. The widespread use of the telephone has had a profound impact on society

32. La labradora de mi hermana es muy cariñosa y siempre está buscando atención.

33. Puwede ba bumili ng tiket dito?

34. Los sueños son el motor que nos impulsa a lograr nuestras metas. (Dreams are the engine that drives us to achieve our goals.)

35. Scissors are an essential tool in classrooms for art projects and cutting paper.

36. I heard that the restaurant has bad service, but I'll take it with a grain of salt until I try it myself.

37. Dahil matamis ang dilaw na mangga.

38. Gusto ko sanang makabili ng bahay.

39. Akin na kamay mo.

40. Let's keep things in perspective - this is just a storm in a teacup.

41. Es importante ser honestos con nosotros mismos para tener una buena conciencia.

42. Madalas na nagiging dahilan ng utang ang kawalan ng sapat na pera upang matugunan ang mga pangangailangan.

43. The Petra archaeological site in Jordan is an extraordinary wonder carved into rock.

44. La esperanza es un recordatorio de que siempre hay algo bueno en el futuro, incluso si no podemos verlo en el momento. (Hope is a reminder that there is always something good in the future, even if we can't see it at the moment.)

45. Mas maganda ang photoshoot sa dapit-hapon dahil ang ilaw ay nakakapagbigay ng ibang vibe.

46. Der er forskellige identiteter inden for transkønnethed, herunder non-binær og genderfluid.

47. Pumunta sila sa albularyo upang magpagamot ng kanyang pananakit ng likod.

48. Nakinig ang mga estudyante sa guro.

49. Pinaluto ko ang adobo sa nanay ko.

50. Araw-araw na bumalik ang prinsesa sa kagubatan hanggang ang bulaklak ay napalitang ng bunga.

Similar Words

MontrealReallyrealizacirealistic

Recent Searches

realtatawagandresssatisfactionprinsipesizekailanganrepublicanmalumbayiyannagc-craveafternoonipakitaglobalisasyoneffectspedehenrytunaytenniskisspinabulaanospitalkatawanlibagthemnanaytinanggapambamundokamatishimigkumitasagotdahilanrebolusyonbukawritingmasayang-masayakalaunantagumpaypersonalpaanonapakatalinosuzettesinbeyondbakitkinayatexttagalogabopawiskinagalitankabilangbabalikdansketamapagbabagong-anyobrightmanonoodskillsmaglalarousaanumanpagtatanonggenerabangusocultivobayankukuhagiverlendingpermitetuwingbusilakpumapasokreplacedreorganizingrelevanthalamangrelativelyhalamanregalorealisticobtenernuevosakmangtryghedlayasnogensindesupilinalilaintatayokayakumakainbiyaheninaakmanapadpadterminopagpapasakittayomababangiskaarawanpare-parehonakapagproposeditokuripotpunosapagkatasulnaroonpalapagangelicasinulidhanginbulongnagpapasasaganidnakaliliyongdiretsahangkapatidmaniwalawaringunti-untingisapangarapnagbagolorenangunitpinyamatuklasansinkmanunulatculturenagmungkahinalugiamazoncreatetherapynakasuotbanaweschoolperformanceperseverance,tumingaladentistatumamisgabingtamaanmabangiscorporationteleponoboxmalalimtaontumikimhawlacompostelainomislaikinasuklamentonceshahatawageeeehhhhstagekalikasanbagaykalakihannagpabakunamahinakongfidelpinakabatangpagtungolumitawagam-agamdagat-dagatandilawnapakahangaadvanceskasawiang-paladnabalitaannanaiggatheringininomnasisiyahansambitbulakalakgrabedvdkuninnagalitpangakopinalakinghydelbumalingbrindarexhaustion