Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

23 sentences found for "real"

1. Algunas serpientes, como la cobra real y la serpiente de cascabel, son conocidas por sus capacidades defensivas y sus venenos letales.

2. But there is a real fear that the world’s reserves for energy sources of petroleum, coal, and hydel power are gradually being exhausted

3. Facebook Live enables users to broadcast live videos to their followers and engage in real-time interactions.

4. Foreclosed properties are often sold at a discounted price, making them an attractive option for real estate investors.

5. Foreclosed properties may be sold through real estate agents or brokers, who can help buyers navigate the purchase process.

6. Grande married Dalton Gomez, a real estate agent, in May 2021 in a private ceremony.

7. I fell for an April Fool's joke on social media this year - a friend posted a fake news article that was so convincing I thought it was real.

8. Instagram also supports live streaming, enabling users to broadcast and engage with their audience in real-time.

9. Investors can invest in a variety of asset classes, such as stocks, bonds, real estate, and commodities.

10. Las noticias en línea pueden ser actualizadas en tiempo real.

11. Lazada has launched a live streaming feature that allows sellers to showcase their products and interact with customers in real-time.

12. Limitations can be perceived or real, and they can vary from person to person.

13. Mathematics can be used to model real-world situations and make predictions.

14. Microscopes can be used to study living organisms in real-time, allowing researchers to observe biological processes as they occur.

15. Pinocchio is a wooden puppet who dreams of becoming a real boy and learns the importance of honesty.

16. Real estate investing: Invest in real estate through online platforms like Fundrise or Roofstock

17. Stocks and bonds are generally more liquid than real estate or other alternative investments.

18. The acquired assets included a portfolio of real estate properties.

19. The author was trying to keep their identity a secret, but someone let the cat out of the bag and revealed their real name.

20. The charity made a hefty donation to the cause, helping to make a real difference in people's lives.

21. The Velveteen Rabbit is a heartwarming story about a stuffed toy who becomes real through the love of a child.

22. Trump was known for his background in real estate and his role as a television personality on the show "The Apprentice."

23. Twitter has millions of active users worldwide, making it a powerful tool for real-time news, information, and social networking.

Random Sentences

1. Bilang paglilinaw, ang sinabi kong deadline ay sa Biyernes, hindi sa Sabado.

2. Ang tubig-ulan ay nagbibigay ng kahalagahan sa mga pangangailangan ng mga tao, tulad ng pag-inom at pangangailangan sa pagsasaka.

3. Las plantas con flores se reproducen a través de la polinización, en la que los insectos u otros agentes transportan el polen.

4. Pumasok po sa restawran ang tatlong lalaki.

5. The Cybertruck, an upcoming electric pickup truck by Tesla, has garnered significant attention for its futuristic design and capabilities.

6. Ang mga anak-pawis ay kadalasang nakakaranas ng diskriminasyon sa lipunan.

7. It's never a good idea to let the cat out of the bag when it comes to confidential information - it can have serious consequences.

8. The train was delayed, and therefore we had to wait on the platform.

9. Limitations can be cultural or societal, such as gender roles or stereotypes.

10. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

11. Sa panahon ng kalamidad, mahalaga ang bayanihan upang mapabilis ang pagtulong sa mga nangangailangan.

12. Doa adalah upaya komunikasi seseorang dengan Tuhan atau kekuatan yang lebih tinggi.

13. Isang maliit na kubo ang nakatayo sa itaas ng baranggay, sa tagiliran mismo ng bundok na balot ng makapal na gubat.

14. Sa tindi ng init, pakiramdam ko’y nagbabaga na ang lupa sa ilalim ng aking mga paa.

15. Marami kaming handa noong noche buena.

16. La science des matériaux est utilisée dans la fabrication de nombreux produits de la vie quotidienne.

17. Ako ay nagtatanim ng mga halaman sa aking bakuran.

18. Si Juan ay nangahas na magtapat ng pag-ibig kay Maria sa kabila ng kanyang takot na ma-reject.

19. Puwede kang magguhit ng mga larawan ng iyong pamilya at kaibigan upang ipakita ang pagmamahal sa kanila.

20. Las redes sociales también son un medio para hacer negocios y promocionar productos.

21. Maaari ring magdulot ng agam-agam ang pagbabago sa buhay tulad ng paglipat sa ibang lugar o pagbabago ng trabaho.

22. Sa kanyang masamang gawain, nai-record ng CCTV kung paano siya na-suway sa patakaran ng paaralan.

23. Dadalaw ako kay Lola Sela bukas.

24. Lumapit sakin si Kenji tapos naka smile siya.

25. El nacimiento es el momento en que un bebé sale del útero de la madre.

26. The Amazon Rainforest is a natural wonder, home to an incredible variety of plant and animal species.

27. Hiramin ko muna ang iyong libro para magkaruon ako ng kopya nito.

28. El romero es una hierba aromática que se usa frecuentemente en la cocina mediterránea.

29. The invention of the telephone led to the creation of the first radio dramas and comedies

30. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

31. La conciencia nos ayuda a entender el impacto de nuestras decisiones en los demás y en el mundo.

32. The experience of bungee jumping was both terrifying and euphoric.

33. Balak po naming bumalik sa susunod na linggo.

34. There are different types of scissors, such as sewing scissors, kitchen scissors, and craft scissors, each designed for specific purposes.

35. Iniisip ko ang aking mga pangarap, datapwat alam kong ito ay magiging mahirap abutin.

36. May dalawang puno sa harap ng bahay namin.

37.

38. Les chimistes travaillent sur la composition et la structure de la matière.

39. Sa sobrang dami ng mga dapat gawin, may mga pagkakataon na naglilimot siya sa ilang mga mahahalagang mga takdang-aralin.

40. Ayaw siyang pagawain sa bahay at sustentado siyang mabuti sa pagkain.

41. Napakalakas ng kanyang halinghing dahil sa sobrang kalungkutan.

42. Magkahawak kamay silang namasyal sa gubat ng magagandang halaman na ang buwan at mga bituin ang tumatanglaw sa kanilang dinadaanan.

43. Salamat sa iyo kaibigan, nailigtas mo ako sa kamay ng itim na salamangkera.

44. Ang kalayaan ay hindi dapat magresulta sa pagpapahirap sa ibang tao.

45. Foreclosed properties can be a good option for those who are willing to put in the time and effort to find the right property.

46. Facebook Marketplace is a platform where users can buy and sell items locally.

47. It was risky to climb the mountain during a thunderstorm.

48. Comer una dieta equilibrada puede aumentar los niveles de energía y mejorar el estado de ánimo.

49. AI algorithms can be trained using large datasets to improve their accuracy and effectiveness.

50.

Similar Words

MontrealReallyrealizacirealistic

Recent Searches

naritobarangayarturovetosupilinrealnaalisbinulongestosmayamanghappypinagkiskisipinadalapinapakainiwinasiwasigigiitrolandantoniomatandanggalitcongresssalaminhalu-haloklasenaulinigannanaloelenapinagmamasdanyoutubebuhawibighanimedisinaislandvedeksenatuktokdreamespecializadasengkantadabilihine-commerce,binuksannasasalinansuzetteplayshihigitlockedareasspeedtonomukasiyudadnagreklamobroughtmakikiligowasaklikelykontingipatuloyiniintaysinusuklalyanmakulitmournedaksidentemonsignorhitiknagsisigawcriticscolourpauwiinspireddefinitivomaaringmartianmagsi-skiingpagkattiningnanrelyjolibeesuotfueltosamapakelamelectiniisipgalingmatindingnapatingintutungoplatformseheheconsidertoreteanubayantargetagilityhellopreviouslydiscoveredstagesigurocarlopaycadenavelfungerendetamatakotmrsprogressnagreplylibingduloatensyonglasingmakakabalikvotesnapapansinerrors,pacebadingmakalingrecentjoshuaoperatepresentnagdarasalaskkalikasanbesidestig-bebenteseasoncapitalistisinawaknasaanheheorasmasayadiyanmarahangthereforedatapuwaihahatidnagbagopanindapantheonatepalabukas1876selebrasyonrosabibigyanincreasesmedikalbroadcastinghapdimahuhulimarielguardawifiproperlyworkshopcontrolarlasnamanfreelancergamesnakatuonthroatnagtataaspronounbuslonakauwitelangpaciencianakalilipasnaiwangmagasawangaanhingagawintenidobrasonakagalawipinatawagmanylaborreallypagtangisnagwagiitakparticipatingtumindignanghihinamadtermmagsabikumidlathinalungkatubomagdaraosydelser