Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

13 sentences found for "presence"

1. A father's presence and involvement can be especially important for children who do not have a father figure in their lives.

2. Facebook Pages allow businesses, public figures, and organizations to create a public presence and interact with their audience.

3. He is also remembered for his incredible martial arts skills, his charismatic stage presence, and his dedication to personal development

4. He was also known for his charismatic stage presence and unique vocal style, which helped to establish him as one of the most iconic figures in American music

5. He was known for his active and controversial presence on social media, particularly Twitter.

6. His unique blend of musical styles, charismatic stage presence, and undeniable talent have cemented his place in the pantheon of American music icons

7. She has a strong social media presence, boasting millions of followers on platforms like Instagram and Twitter.

8. Tesla has expanded its operations globally, with presence in various countries and plans for further expansion.

9. The company's acquisition of new assets will help it expand its global presence.

10. The Lakers have a strong philanthropic presence in the community, supporting various charitable initiatives and organizations.

11. The Lakers have a strong social media presence and engage with fans through various platforms, keeping them connected and involved.

12. This can include creating a website or social media presence, reaching out to book reviewers and bloggers, and participating in book signings and events

13. Yumabong ang mga negosyo na mayroong social media presence dahil sa kanilang pagkakaroon ng mas malawak na market.

Random Sentences

1. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

2. Naku, ang taas pala ng temparatura ko.

3. La poesía de Whitman tiene una belleza sublime que transmite su amor por la naturaleza.

4. Ang bayanihan ay nagpapakita ng kahalagahan ng pagtutulungan at pagkakaisa sa pagharap sa mga suliranin.

5. Ang mga bayani ay mga taong nagsakripisyo para sa kalayaan at kabutihan ng bayan.

6. Mula pagkabata ay naging magkaibigan na si Lando at Maria.

7. El Día de San Valentín es una oportunidad para demostrar el amor que sentimos por nuestras parejas.

8. The team's logo, featuring a basketball with a crown on top, has become an iconic symbol in the world of sports.

9. Crush kita alam mo ba?

10. Nagre-review sila para sa eksam.

11. Frustration is a feeling of disappointment, annoyance, or anger that arises when we are unable to achieve a desired outcome.

12. Naidlip siya at nang magising, nakita niya ang magandang dilag.

13. Sa pagkakaroon ng kalamidad, ang mga biktima ay nag-aapuhap ng emergency relief mula sa mga rescue teams.

14. Setiap orang memiliki definisi kebahagiaan yang berbeda-beda.

15. Ang pagkuha ng sapat na pahinga at tulog ay isang nakagagamot na paraan upang maibalik ang aking enerhiya at sigla.

16. Elektroniske apparater kan hjælpe med at forbedre undervisning og læring i uddannelsessystemet.

17. Hindi lang militar ang nakikinabang sa digmaan, maaari rin itong magbigay ng oportunidad sa mga negosyante.

18. Les personnes âgées peuvent être sujettes à des chutes et d'autres accidents.

19. Nakilala ko ang taong pinapangarap ko kaya masayang-masaya ako ngayon.

20. Les habitudes de vie saines peuvent aider à prévenir les maladies et à maintenir une bonne santé tout au long de la vie.

21. Busy sa paglalaba si Aling Maria.

22. Nangahas siyang tumulong sa biktima ng aksidente kahit wala siyang kaalaman sa first aid.

23. Les chimistes travaillent sur la composition et la structure de la matière.

24. Ang pambansang bayani ng Pilipinas ay si Jose Rizal.

25. Offering forgiveness doesn't mean we have to continue a relationship with someone who has repeatedly hurt us; setting boundaries is important for self-care.

26. Menghadapi tantangan hidup dengan keberanian dan tekad dapat membantu kita tumbuh dan mencapai tujuan yang kita impikan.

27. Julia Roberts is an Academy Award-winning actress known for her roles in films like "Pretty Woman" and "Erin Brockovich."

28. During hospitalization, patients receive medical care from doctors, nurses, and other healthcare professionals.

29. Disente tignan ang kulay puti.

30. Cancer research and innovation have led to advances in treatment and early detection.

31. Hay muchos géneros de música, como el rock, el pop, el jazz y el clásico.

32. I know we're behind schedule, but let's not cut corners on safety.

33. Mahal ko ang pusa ko dahil malambing siya.

34. Working in a supportive and positive environment can improve job satisfaction.

35. Tomar decisiones que están en línea con nuestra conciencia puede ayudarnos a construir una vida significativa y satisfactoria.

36. Este plato tiene un toque picante que lo hace especial.

37. The scientific community is working to develop sustainable energy sources to combat climate change.

38. Mahigpit namang ikinabit ng mga halaman ang mga ugat sa ilalim ng lupa.

39. The restaurant was full, and therefore we had to wait for a table.

40. Nangahas ang manunulat na talakayin ang kontrobersyal na isyu sa kanyang aklat.

41. This is my girl, Jacky. pagpapakilala ni Maico sa akin.

42. Di Indonesia, bayi yang baru lahir biasanya diberi nama dengan penuh makna dan arti.

43. Ang pagtangging harapin ang mga hindi kanais-nais na katotohanan ay nagpapakita ng pagiging bulag sa katotohanan.

44. En tung samvittighed kan nogle gange være et tegn på, at vi har brug for at revidere vores adfærd eller beslutninger.

45. Forgiveness is a powerful act of releasing anger and resentment towards someone who has wronged you.

46. We need to optimize our website for mobile devices to improve user experience.

47. Mahilig siya sa pagluluto, datapwat madalas ay hindi niya nasusunod ang tamang recipe.

48. The acquired assets will improve the company's financial performance.

49. Late ako kasi nasira ang kotse ko.

50. Nakipagtagisan sya ng talino sa kapwa estudyante.

Similar Words

presence,

Recent Searches

presenceduwendenuevokaniyangreboundbagkusinfluencesdasalganitohanginpublicitymaongmatikmankaybilishumpaysundaemulighedernaglabananinatakebilaowaterparurusahangardenginawasacrificemarangyanglivesklasrumnagbasarobinhoodcountriesamongsumunodkumatokbehindpancitwesternpresyokalahatingbinilhanbinasamemberssikobililenguajetiyaseendilimbernardosumabogadversetonightbalinganpagodsinagotmedidabigoteheftykumbinsihinprosperspendingcoatpookgulobironyepersonalhumanoroonbadmaglalakadredmasasayaheisentencesutiltalagangwealthmeanpunung-punotumawawestnilutogamesistasyonconsideredhimselftupelobakepackagingmapapagooglemonitorhoweveriginitgitgapdulotcompletinglearnalignshumigabunganguniteksampodcasts,niyognamumuongboksingdon'tnagsasanggangnaghihirapnamumutlahatingkuripotdawmagdamagpublicationdropshipping,editortumalonliligawanikinabubuhayhinihintayteachingschoipagbatianimoyfourpaghuhugasgabipisomalapitanpagkakapagsalitapaga-alalapesoumigibmabaitlalakebinatakwastewebsitesipamatanggaptakeselectionsusaagaulobangpagtataasmatigasnagawantilgangmarkednaggingpulapaaexhaustedpalagiparkmangyarinagkapilatkinauupuankandoymakakasahodpaginiwanmensahetinakasannagtuturoadaptabilitylumibotrevolutioneretpapaanodingdinggelaiangkaninompahabollalimdumilatpagiisiphabitkaharianmarielrecordedmaglabatiningnanbakanteulapmejopagtataposbuenaanumanpinalutoaywanfans00amgabemaasahanjackz