Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

13 sentences found for "presence"

1. A father's presence and involvement can be especially important for children who do not have a father figure in their lives.

2. Facebook Pages allow businesses, public figures, and organizations to create a public presence and interact with their audience.

3. He is also remembered for his incredible martial arts skills, his charismatic stage presence, and his dedication to personal development

4. He was also known for his charismatic stage presence and unique vocal style, which helped to establish him as one of the most iconic figures in American music

5. He was known for his active and controversial presence on social media, particularly Twitter.

6. His unique blend of musical styles, charismatic stage presence, and undeniable talent have cemented his place in the pantheon of American music icons

7. She has a strong social media presence, boasting millions of followers on platforms like Instagram and Twitter.

8. Tesla has expanded its operations globally, with presence in various countries and plans for further expansion.

9. The company's acquisition of new assets will help it expand its global presence.

10. The Lakers have a strong philanthropic presence in the community, supporting various charitable initiatives and organizations.

11. The Lakers have a strong social media presence and engage with fans through various platforms, keeping them connected and involved.

12. This can include creating a website or social media presence, reaching out to book reviewers and bloggers, and participating in book signings and events

13. Yumabong ang mga negosyo na mayroong social media presence dahil sa kanilang pagkakaroon ng mas malawak na market.

Random Sentences

1. Puwede bang makausap si Clara?

2. Sayang, kapan kita bisa bertemu lagi? (Darling, when can we meet again?)

3. The patient's family history of high blood pressure increased his risk of developing the condition.

4. Punung-puno ng bunga ang puno, ngunit sobrang asim naman ng laman.

5. The app has also become a platform for discovering new music, with songs going viral through TikTok.

6. Iniintay ka ata nila.

7. Ang mga nangunguna sa industriya ay kadalasang itinuturing bilang mga eksperto at mga awtoridad sa kanilang larangan.

8. The charitable organization provides free medical services to remote communities.

9. Mababaw ang swimming pool sa hotel.

10. Muchas ciudades tienen museos de arte que exhiben obras de artistas locales e internacionales.

11. Sikat ang mga Pinoy vloggers dahil sa kanilang creativity at humor.

12. I do not drink coffee.

13. I have a craving for a piece of cake with a cup of coffee.

14. Los héroes pueden ser aquellos que defienden los derechos humanos y luchan contra la opresión.

15. Baka makatatlo pa ang kanyang nanay ngayon!

16. I can't keep it a secret any longer, I'm going to spill the beans.

17. Doa dapat dilakukan kapan saja dan di mana saja, tidak harus di tempat ibadah.

18. The Lakers have retired numerous jersey numbers in honor of their legendary players, including numbers 8 and 24, worn by Kobe Bryant.

19. Masyadong advanced ang teknolohiya ng bansang Japan kung ikukumpara sa ibang bansa.

20. Certaines personnes sont prêtes à tout pour obtenir de l'argent.

21. Ang apoy sa kalan ay nagbabaga pa rin kahit patay na ang apoy.

22. Don't put all your eggs in one basket

23. Ang mga kabayanihan ng mga sundalo at pulis ay kailangan ituring at kilalanin bilang mga halimbawa ng tapang at dedikasyon.

24. Baka roon matutong matakot iyan at magsabi ng totoo.

25. Hinahayaan kong lumabas ang aking poot upang maipahayag ang aking saloobin at damdamin.

26. Matagal-tagal ding hindi naglabada ang kanyang ina, nahihiyang lumabas sa kanilang barungbarong.

27. Pupunta lang ako sa comfort room.

28. Ang abuso sa hayop ay isang krimen na dapat mapanagot ang mga nagkasala.

29. Hanggang ngayon, si Hidilyn Diaz ay patuloy na nagsasanay at sumusuporta sa mga atletang nangangarap tulad niya.

30. Halos magkasing-edad sila ni Bereti kaya madaling nagkalapit ang mga loob.

31. Kapag ang puno ay matanda na, sa bunga mo makikilala.

32. Nous avons prévu une lune de miel en Italie.

33. A couple of lovebirds were seen walking hand-in-hand in the park.

34. Kakutis ni Kano ang iba pa niyang kapatid.

35. My dog hates going outside in the rain, and I don't blame him - it's really coming down like it's raining cats and dogs.

36. Sa kalagitnaan ng pagbabasa, nagitla ako nang biglang mag-flash ang ilaw sa kuwarto.

37. Pasensya na, hindi kita maalala.

38. Laking pagkamangha ni Aling Rosa ng makita ang anyo ng bunga nito.

39. Sila ang unang angkan ng mga aso sa daigdig.

40. Nalaman ni Bereti na madalas sumala sa oras sina Karing.

41. Recycling and reducing waste are important ways to protect the environment and conserve resources.

42. Mahal na mahal ni Aling Rosa ang kanyang bugtong na anak.

43. The elephant in the room is the fact that we're not meeting our sales targets, and we need to figure out why.

44. En invierno, los árboles pierden sus hojas y se vuelven caducos.

45. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

46. Magaling sumayaw ng Tinikling si Gabe.

47. Nanlalamig, nanginginig na ako.

48. I prefer to arrive early to job interviews because the early bird gets the worm.

49. Hindi ito maganda na maging sobrang takot sa lahat ng bagay dahil lamang sa agam-agam.

50. Chris Hemsworth gained international recognition for his portrayal of Thor in the Marvel Cinematic Universe.

Similar Words

presence,

Recent Searches

nakakapuntaretirarjolibeerenaianatutuwapresenceanteshinahaplosbankvegasestadosmaghapongmandirigmangbarcelonauniversitiesbihirapromisechristmaspinisilrieganatitirangsampungbahagyanginfusionesganundadalonayonnamanmabutipatongkundikinalimutancashnilalangexperience,institucioneskumapitturonumibigalagahacerinnovationgloriaanungmarinigpangakoligaligisipannababalotprosesogreatlysakimlunesnapagodbooksnasuklamtypessikipbalingandiseasekutsilyopagkaingnapakotangandiaperbutitamadsandalingshoppingbagamaandoygjortfederalcocktailtagakkalongsineinvitationlagunapeppybinanggasumingitsumisilipmissiontinikdasalwikagustojuanplagaslalaketusindvishagdantamispanitikannanaymaliitwednesdayapologeticamericanofrecenlandangkanyatadisyembreilocossumuothappenedwastedissegiverbalangkaarawanginaganoonmanghulifulfillingpangalanbateryatoyfitrenatoknightinangnetflixhikingenergihiningimustdangeroussinimulanparilotdyipgranadaiilannagdarasalhdtvparangleadinganiyainantaypepekagandahinigitsawaassociationtsakaareasipinasyanginterestsaumentarpabalangconsistdiamondanimoysiemprepierultimatelyabrilreplacedisaacnumerosasdiagnosesvehiclesipatuloybeganpangitokaysigenapatingalaipapaputolfionamadurasonlinemorenatanoderangamitingrammardecisionsipagamotboyetleftstarlimosfireworkssumindiexamsystematiskkamatisdollybernardoahitfeltwestasulcollectionsmagdacivilizationaywan