Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "makulong"

1. Malaya na si Jerry matapos itong makulong ng limang taon.

Random Sentences

1. Nagpasama ang matanda sa bahay-bahay.

2. The concept of money has been around for thousands of years and has evolved over time.

3. Naghingi ako ng pahintulot na hiramin ang kotse ng aking magulang para sa isang family outing.

4. John and Tom are both avid cyclists, so it's no surprise that they've become close friends - birds of the same feather flock together!

5. El nacimiento de un bebé puede tener un gran impacto en la vida de los padres y la familia, y puede requerir ajustes en la rutina diaria y las responsabilidades.

6. Ang mga estudyante ay bumalik na sa kanilang mga dormitoryo sa hatinggabi.

7. The moon shines brightly at night.

8. May gusto lang akong malaman.. I have to ask him.

9. "Every dog has its day."

10. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

11. I reached my credit limit on the card and couldn't make any more purchases.

12. Eh gaga ka pala eh, gag show mo mukha mo.

13. La labradora de mi hermana es muy cariñosa y siempre está buscando atención.

14. Motion kan udføres alene eller sammen med andre, såsom i holdtræning eller sportsaktiviteter.

15. Las redes sociales tienen un impacto en la cultura y la sociedad en general.

16. The intensity of baby fever can vary from person to person, with some feeling a passing longing and others experiencing a persistent and overwhelming desire.

17. Kinuha nya yung wallet nya at inabot yung bayad.

18. Si te gusta la comida picante, prueba el guacamole con jalapeño.

19. Kumusta ang bakasyon mo?

20. Ang paglapastangan sa mga kagamitan at ari-arian ng iba ay isang paglabag sa mga prinsipyong moral.

21. Sa kaibuturan ng aking puso, alam kong tama ang aking ginagawa.

22. The United States has a Bill of Rights, which is the first ten amendments to the Constitution and outlines individual rights and freedoms

23. Nakapila ako sa bayad center upang magbayad ng kuryente.

24. Many wives have to juggle multiple responsibilities, including work, childcare, and household chores.

25. ¡Muchas gracias por el regalo!

26. Maraming bagong laruan sina Justin at Andre.

27. La santé des femmes est souvent différente de celle des hommes et nécessite une attention particulière.

28. Naglalambing ang aking anak.

29. Diyan ang bahay ni Mr. Marasigan.

30. The exhibit features a variety of artwork, from paintings to sculptures.

31. The meeting was cancelled, and therefore he had the afternoon off.

32. Hindi ko gusto ang kanyang maarteng pananalita tungkol sa kanyang pagkain.

33. Upang magawa ito, pinag-aralan niyang makapagsalita ng kanilang wika.

34. Sa eroplano, hinde ko mapilitang hinde malungkot.

35. Maluwag ang parisukat na sementong kinatitirikan ng gripo at ang dulo ng pila'y nasa labas pa niyon.

36. Beauty? tanong pa ni Mrs. Lacsamana.

37. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

38. She is not playing with her pet dog at the moment.

39. The United States has a strong tradition of individual freedom, including freedom of speech, religion, and the press.

40. Ha? Ano yung last na sinabi mo? May binulong ka eh.

41. Mangungudngod siya, mahahalik sa lupa.

42. The Statue of Liberty in New York is an iconic wonder symbolizing freedom and democracy.

43. Ang aking teacher ay hindi muna nagturo ngayong araw.

44. Natakot ang batang higante.

45. Elvis Presley, also known as the King of Rock and Roll, was a legendary musician, singer, and actor who rose to fame in the 1950s

46. Naglaro sina Paul ng basketball.

47. Nabasa niya ang isang libro at matapos niyang basahin, naglimot na agad siya sa mga pangunahing detalye ng kwento.

48. Samvittigheden er vores indre stemme, der fortæller os, hvad der er rigtigt og forkert.

49. Maraming taong sumasakay ng bus.

50. Nationalism is a complex and multifaceted phenomenon that continues to shape the modern world.

Recent Searches

makulonglumakingvidenskabinvolvebagnapaplastikankailanganrelyangpagpilinakasakayfe-facebookpanatilihintuloy-tuloyngisitinaaskapitbahayalapaaplifeageebidensyalenguajeulambagkusiwinasiwasmagandangisinamabagyonagpatuloykonghetonasasakupanmakapagsabikisapmatalumahokpogipinangaralankinamumuhiansamantalangteknologibatoleveragecaracterizatiyakpinakamaartenglokohinpinag-aaralanalas-diyescornerspantalongchartsdiettypesinformedhellorevolucionadotuloypagpalitprocesseshimutokfrogyumabongtsinatamaanpagluluksabaclarannakikihukaytmicahuwebespaki-chargeanakdalibabesdamiitukodoperahansusunduinreguleringeleksyonborntaposnutsbasketballreallysentenceclimanakasuotpalagingubodpakaininforskelcomputerpabalikamingatentonagtatakakinausapano-anoctricaskasuutanlutokauntipagkabuhaystudentculturesninyodotanahuluganumokayasignaturatessdapatmay-bahaycrosscitizensactortambayanniyanganghomespalakaheinamamsyaltinataluntonkunehotrabahopitongmanuscripttelebisyonkasaganaanprinsesaharapintinitindatumulongumaapawfurtinawagnilalangkalanbastasubject,nagpalutonagsasabingoscarpasiyentebillmarmaingkarunungankiloiikotmagdilimbakasyonmasayafriendsmalambingsumasambakinagagalakconvertingalassaidmaingatrosarioanak-pawiskaugnayanbusinessesunitednami-misshampasehehepanatagpaksanakaririmarimsubalitsalapinapagodaplicacionespetspeechesagwadormakapalnariningestilostwomatiyakpassionsandaliflexiblemasayang-masayanapakaalatfratransmitskotsengrestawranhinagismanakbodadanapabook,pagodhinding-hindi