Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

26 sentences found for "facebook"

1. Facebook allows users to send private messages, comment on posts, and engage in group discussions.

2. Facebook Events feature allows users to create, share, and RSVP to events.

3. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

4. Facebook has become an integral part of modern social networking, connecting people, fostering communities, and facilitating communication across the globe.

5. Facebook has billions of active users worldwide, making it one of the largest social media platforms.

6. Facebook has faced controversies regarding privacy concerns, data breaches, and the spread of misinformation on its platform.

7. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

8. Facebook Live enables users to broadcast live videos to their followers and engage in real-time interactions.

9. Facebook Marketplace is a platform where users can buy and sell items locally.

10. Facebook Memories feature reminds users of posts, photos, and milestones from previous years.

11. Facebook Messenger is a standalone messaging app that allows users to have private conversations with friends and contacts.

12. Facebook offers targeted advertising options for businesses and organizations to reach specific audiences.

13. Facebook offers various features like photo albums, events, marketplace, and games to enhance user experience and engagement.

14. Facebook Pages allow businesses, public figures, and organizations to create a public presence and interact with their audience.

15. Facebook provides tools for businesses to create and manage advertisements, track analytics, and engage with their target audience.

16. Groups on Facebook provide spaces for people with shared interests to connect, discuss, and share content.

17. Lagi na lamang itong nag fe-facebook.

18. Matagal ko na syang kaibigan sa Facebook.

19. Nakita ko sa facebook ang dati kong kaklase.

20. Panay pa ang post nito sa facebook ng bagong damit eh hiram lang naman nya ang lahat nang yun.

21. Privacy settings on Facebook allow users to control the visibility of their posts, profile information, and personal data.

22. Sa facebook ay madami akong kaibigan.

23. Sa facebook kami nagkakilala.

24. The "News Feed" on Facebook displays a personalized stream of updates from friends, pages, and groups that a user follows.

25. Users can create profiles, connect with friends, and share content such as photos, videos, and status updates on Facebook.

26. Users can like, react, or share posts on Facebook to show their engagement and support.

Random Sentences

1. El arte callejero es una forma popular de arte urbano.

2. Lalo itong nalungkot nang malamang magdaraos ng isang handaan ang Adang kagubatan.

3. Matapos masaksihan ang kababalaghang iyon ay saka pa lang nalaman ng mga kanayon ang pagiging diwata ni Tarcila.

4. Mahalaga sa aming angkan ang pagpapakita ng respeto sa nakatatanda.

5. Foreclosed properties may be sold through auctions, which can be a fast-paced and competitive environment.

6. These films helped to introduce martial arts to a global audience and made Lee a household name

7. Hinugot niya ang lakas ng kanyang katawan upang maitulak ang sasakyan na nabangga.

8. Translation: I cannot change the past, I can only accept it with "what will be, will be."

9. Coffee shops and cafes have become popular gathering places for people to socialize and work.

10. Maagapan natin ang walang humpay na paghaba ng kaniyang buhok, subalit hindi na natin maibabalik ang normal na kapal nito.

11. Marahil ay nai-stress ka dahil sa mga kailangang tapusin sa trabaho.

12. Ano ang gustong sukatin ni Andy?

13. Mura lang ang mga damit sa Greenhills.

14. The United States has a system of federalism, where power is divided between the national government and the individual states

15. Has he finished his homework?

16. Hi Jace! Mukhang malakas na tayo ah! biro ko sa kanya.

17. Ano ang kinakain niya sa tanghalian?

18. They have studied English for five years.

19. Market indices such as the Dow Jones Industrial Average and S&P 500 can provide insights into market trends and investor sentiment.

20. Ang pangalan ni Carlos Yulo ay patuloy na magiging simbolo ng tagumpay ng atletang Pilipino.

21. Bumili ako ng prutas sa Berkeley Bowl.

22. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

23. Napakaseloso mo naman.

24. Babasahin ko? medyo naiilang kong sabi.

25. Baket? Gusto mo na ba akong umuwi? balik tanong niya.

26. Ang paglapastangan sa mga kagamitan at ari-arian ng iba ay isang paglabag sa mga prinsipyong moral.

27. He used TikTok to raise awareness about a social cause and mobilize support.

28. Sa Manila Hotel ka titigil, hindi ba?

29. Nagbabaga ang araw sa gitna ng tanghali, dahilan upang mabilis na matuyo ang mga damit.

30. Les programmes sociaux peuvent aider à réduire la pauvreté et l'inégalité.

31. Napagalitan si Juan dahil na-suway siya sa paglabag sa traffic rules.

32. Binili ko ang sapatos dahil sa kanyang magandang disenyo, bagkus ito ay hindi gaanong komportable isuot.

33. Hakeem Olajuwon was a dominant center and one of the best shot-blockers in NBA history.

34. Sa pagsalubong ng Bagong Taon, ang langit ay hitik sa mga kulay sa pamamagitan ng mga paputok at mga fireworks display.

35.

36. But television combined visual images with sound.

37. One of the most significant areas of technological advancement in recent years has been in the field of communications

38. Bawal magpakalat ng mga pekeng balita dahil ito ay maaaring makapagpahayag ng maling impormasyon.

39. Las hojas del libro están todas marcadas con notas adhesivas.

40. Tulad ng sinabi nito, ang ulan ay hindi na huminto pa.

41. Cancer can be treated through a variety of methods, including surgery, chemotherapy, radiation therapy, and immunotherapy.

42. Unti-unting lumapad yung ngiti niya.

43. Ang puno ng mangga sa bakuran namin ay hitik sa malalaking bunga ngayong tag-init.

44. El teatro experimental presenta una interpretación sublime del teatro moderno.

45. Wala na siguro sya, baka natulog na inantok na.

46. Eine starke Gewissensentscheidung kann uns helfen, uns selbst und andere besser zu respektieren.

47. Ang tubig-ulan ay maaaring gamitin sa pagsasaka at iba pang mga pangangailangan ng mga tao.

48. Nagsmile si Athena tapos nag bow sa kanila.

49. The love that a mother has for her child is immeasurable.

50. Jeg tror, jeg er ved at blive forelsket i ham. (I think I'm starting to fall in love with him.)

Similar Words

fe-facebook

Recent Searches

itakmurangideasmeetmarsofacebookkatabingpitakaunderholderboyetsnareplacedeventsseebranchsigebilaogoodeveningsolartshirtaniyabotantesinimulankinatatalungkuangnagbanggaangayunmantobacconananaginippagtiisanpagpapatubohumalakhakikinasasabikrevolucionadonagkakakainhinipan-hipanginugunitanapakagandanglangkayipapahingapamilyapapanigmatindingnovemberpagbatipagnanasabitbitgitanasmethodswhileamazonbilingiginitgitcommercecountlessalignsanotherworkingexhaustionnakapaligidtatawaganpagmamanehorebolusyonhampaslupapagtataasmagagawakalaunanmagkapatidmaihaharapnagsilapithigantevidtstrakttennisgiyeratumamisprincipalesumiibigmagsisimulapakukuluanestasyonlot,advancementszebrautilizarneedspasukanantokbasketballlumayasfurthernapacurtainsampliakababalaghangandreaasahanhinukaybibilipiyanopesoinspirationrimasadditionbuwayabalingannochepulitikosellingrestawranmarinigfederalinstitucionestanganagilabanlagdedicationpapagalitanmasaksihanambagrestaurantknightabangankarangalanjocelyntusindvisbagkusasiaticcolorsalbahetagaroonexpresanpabalangkagandapumatolsenatepakilutoreguleringbusytitaoposumigawgoalhumbleindustrypaagamemeandoneellenidea:passwordsulinganintroduceperangcadenacomplicatedbumahamuchpreviouslyaddbeginningpetertiyastateformexpectationsvariousareaconclusionkulunganpamagatisdanghinatidmerryaksidentepapalapitmahiwagamaaarikirotmasikmurarodonaoftesinakopmaipapautangngunitnilinissiponpinagsikapanpunongkahoyfatmerlindasalu-salomagpa-checkupmagbabakasyonkadalagahangmang-aawitgratificante,nagmakaawaanibersaryoikinamataysine