Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

8 sentences found for "waste"

1. Besides, smoking cigarettes means a waste of money, since the habit instead of doing any good only causes injury to one’s health and makes one a slave to the addiction

2. Don't waste your money on that souvenir, they're a dime a dozen in the market.

3. Environmental protection requires educating people about the importance of preserving natural resources and reducing waste.

4. He does not waste food.

5. Jangan sampai disayang, manfaatkan waktu dengan baik. (Don't waste it, make good use of your time.)

6. Protecting the environment involves preserving natural resources and reducing waste.

7. Recycling and reducing waste are important ways to protect the environment and conserve resources.

8. They are a great way to use up leftover ingredients and reduce food waste.

Random Sentences

1. Sayang, tolong maafkan aku jika aku pernah salah. (Darling, please forgive me if I ever did wrong.)

2. Cancer is caused by a combination of genetic and environmental factors, such as tobacco use, UV radiation, and exposure to carcinogens.

3. At blive kvinde handler også om at lære at håndtere livets udfordringer og modgang.

4. Higupin ng halaman ang tubig mula sa lupa.

5. Kung ano ang puno, siya ang bunga.

6. Omelettes are a popular choice for those following a low-carb or high-protein diet.

7. Hindi sadyang nasaktan siya nang malaman niyang iniwan siya ng kanyang kasintahan.

8. Dapat magkaroon ng patas na pagtrato sa lahat ng sektor ng lipunan, kabilang ang anak-pawis.

9. Ang mga bayani ay nagpapakita ng matapang na paglaban laban sa pang-aapi at kawalang-katarungan.

10. Ikinalulungkot ko ang balitang yan.

11. Pahiram naman ng dami na isusuot.

12. Oh sige na nga sabi mo eh. hehe.

13. Many countries around the world have their own professional basketball leagues, as well as amateur leagues for players of all ages.

14. Protecting the environment involves preserving natural resources and reducing waste.

15. She has a strong social media presence, boasting millions of followers on platforms like Instagram and Twitter.

16. Ang pagiging hospitable ay likas na katangian ng mga Pinoy.

17. Bukas na pala ang araw ng kalayaan.

18. The musician released a series of singles, leading up to the release of her album.

19. Nag tinda si Aling Pusing ng isda upang may makain ang kanyang mga anak.

20. Les personnes âgées peuvent être victimes d'abus ou de négligence de la part de leur entourage.

21. It's time to address the elephant in the room and discuss the difficult decisions that need to be made.

22. Despite his success, Presley's personal life was plagued by controversy

23. Huh? Anong wala pa? nagtatakang tanong ko.

24. Transkønnede børn og unge skal have adgang til støtte og ressourcer til at udforske deres kønsidentitet i en tryg og støttende miljø.

25. I am teaching English to my students.

26. Kahit hindi ka magaling sa pagguhit, puwede ka pa ring matuto at mag-improve sa pagguhit.

27. Mi amigo del colegio se convirtió en un abogado exitoso.

28. Gusto ko ang pansit na niluto mo.

29. Danske virksomheder, der eksporterer varer til Kina, har haft stor succes på det kinesiske marked.

30. The company suffered from the actions of a culprit who leaked confidential information.

31. Mas mahalaga ang kabutihan ng kalooban kaysa sa kababawang kasiyahan.

32. Nami-miss ko na ang Pilipinas.

33. Pumunta sila dito noong bakasyon.

34. Eh? Anlabo? Hindi mo naman kaboses yun eh.

35. El realismo y el impresionismo son estilos populares en la pintura.

36. Pakibigay ng halimbawa ng mga salitang magkasalungat sa klase.

37. John Quincy Adams, the sixth president of the United States, served from 1825 to 1829 and was the son of the second president, John Adams.

38. Kailangan ng mas magandang oportunidad sa trabaho at edukasyon para sa sektor ng anak-pawis.

39. Les enseignants peuvent participer à des formations continues pour améliorer leurs compétences pédagogiques.

40. Tumahol ang aso at natakot ang pusa.

41. The hiking trail offers absolutely breathtaking views of the mountains.

42. The role of a wife has evolved over time, with many women pursuing careers and taking on more equal roles in the household.

43. Naiinis na talaga ako. Kelangan ko ng tulog.

44. Kenji nandito na siya! sabi sa akin ni Grace.

45. Ang yaman naman nila.

46. The cuisine in Los Angeles reflects its diverse population, offering a wide range of international and fusion culinary experiences.

47. Siya nama'y maglalabing-anim na.

48. Tulala siya sa kanyang kwarto nang hindi na umalis ng buong araw.

49. Unser Gewissen kann uns vor schlechten Entscheidungen bewahren und uns auf den richtigen Weg führen.

50.

Recent Searches

wastecarmenmeronespanyangyunadvancewalkie-talkiemurang-muranakaramdamoktubrepanghabambuhaymagbibiyahepagkakamalikumitapagkakalutohinipan-hipanikinasasabikhinagud-hagodmagtatagaladvertising,gabi-gabitumikimmabihisanpaki-chargemarurumiculturenaabutanmedicalmakukulaynaiyakgirlmini-helicopterlumakasnamataymatapobrengnapakahabahinawakanmaghahatidnananalogiyeranapangitikapangyarihangnai-dialnaglokohanmaginagawpagkamulatumiyakkainitaninilabasginawarancruzipipilitsutilcoloursipaexplainperasumangcomplicatedspendingsueloabibansanagbungamarunongnilayuannagbabagakababalaghangmisyunerongakmangitinaobgalaaniwananmarangyangexpertisesilyasalesmasarapnatagalankinafederalnaminaguabitawanpaskocenternasabingdietlapitannagbasaredigeringmapaibabawaumentarflaviopancitmadurasaroundbulagbatayharinglinyaamoysumabogleoumingitearnmabilisrabecupidelitepierkamiipinageneratestuffedmichaelkartonios4thinterpretingroledonelangmarvintubigmagpa-paskokasingincluderequirebehaviorbowcontrolacompleteedit:refevencrossvankongresorenacentistanaglalakadbagamatnamanpaanodi-kawasacharitablekauristorgusting-gustopublishingritomakikitakamustanangangahoysakimnangagsibiliminu-minutoprocesonakatayocedulagasolinamakabalikdisyembremangingibiglarographicdependingmagmulaavailablekaniyaabigaelpresencepangakodisciplinmaglabaisipane-commerce,magdilimgasmennakakapuntadiliginnatatanawipatuloyanaysuccessfulhojasisinalangkwebamalambingoperahancomunicanpisoblusangbasahinlabingusedcornersedwinrobotic