Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

8 sentences found for "waste"

1. Besides, smoking cigarettes means a waste of money, since the habit instead of doing any good only causes injury to one’s health and makes one a slave to the addiction

2. Don't waste your money on that souvenir, they're a dime a dozen in the market.

3. Environmental protection requires educating people about the importance of preserving natural resources and reducing waste.

4. He does not waste food.

5. Jangan sampai disayang, manfaatkan waktu dengan baik. (Don't waste it, make good use of your time.)

6. Protecting the environment involves preserving natural resources and reducing waste.

7. Recycling and reducing waste are important ways to protect the environment and conserve resources.

8. They are a great way to use up leftover ingredients and reduce food waste.

Random Sentences

1. The market is currently facing economic uncertainty due to the pandemic.

2. Las hierbas medicinales se utilizan desde hace siglos para tratar diversas dolencias.

3. Tantangan hidup dapat menguji kemampuan dan ketangguhan seseorang, membantu kita mengenal diri sendiri dengan lebih baik.

4. Nakangiti siya at ang babae ay ngumiti rin.

5. Maputla ang kulay ng kanyang mukha ay aywan ba niya at pati siya ay tila pinanawan ng lakas.

6. Women have made significant contributions throughout history in various fields, including science, politics, and the arts.

7.

8. Women have been instrumental in driving economic growth and development through entrepreneurship and innovation.

9. Hindi ko alam kung kakayanin ko, pero sana pwede ba kitang mahalin?

10. The children are playing with their toys.

11. Claro, puedes hacer todas las preguntas que quieras.

12. Ano ang sinabi ni Antonio Tinio?

13. It has revolutionized the way we communicate, allowing us to talk to people anywhere in the world at any time

14. Ang Datu ay nalungkot at nawalan ng lakas na harapin ang katotohanan.

15. Ang mahal naman ng laptop na binili ni Andy.

16. Unti-unti na siyang nanghihina.

17. The team's games are highly anticipated events, with celebrities often seen courtside, adding to the glamour and excitement of Lakers basketball.

18. Siya ay hinugot ng mga pulis mula sa kanyang bahay.

19. Ang presidente ng Pilipinas ay nagpabot na ng ayuda sa mga mahihirap.

20. Sa paligid ng balde, nakikia niya ang kanyang anino.

21. Natawa kami sa inasta ni Sara dahil para siyang bata.

22. Aling lugar sa lungsod mo ang matao?

23. Magalang na nagsabi ang estudyante ng "po" at "opo" sa kanyang guro bilang pagpapakita ng respeto.

24. Ano ang gustong orderin ni Maria?

25. Malaki at mabilis ang eroplano.

26. Seperti makan buah simalakama.

27. Madali naman siyang natuto.

28. A balanced and healthy diet can help prevent chronic diseases.

29. Bien que le jeu en ligne puisse être pratique, il est également important de prendre en compte les risques impliqués, tels que la fraude et le vol d'identité.

30. Besides, smoking cigarettes means a waste of money, since the habit instead of doing any good only causes injury to one’s health and makes one a slave to the addiction

31. Matapos magbabala ay itinaas ng matanda ang baston.

32. May lumabas umanong bagong sakit na dapat pag-ingatan ng publiko.

33. The Machu Picchu ruins in Peru are a mystical wonder of the ancient Inca civilization.

34. Nagpasensiya na lang si Aling Rosa, napagsilbihan naman siya kahit paano ng anak.

35. Si te gusta la comida picante, prueba el guacamole con jalapeño.

36. It's important to read food labels to understand ingredients and nutritional information.

37. May sisenta sentimos nang kumakalansing sa bulsa ng kutod niyang maong.

38. La pintura es una forma de expresión artística que ha existido desde tiempos antiguos.

39. I finally finished my degree at age 40 - better late than never!

40. Ah opo, ngayon ko lang napagtanto ng sinabi nya yun.

41. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

42. Mathematical proofs are used to verify the validity of mathematical statements.

43. The police were trying to determine the culprit behind the burglary.

44. He has been writing a novel for six months.

45. I am not listening to music right now.

46. Ang nagliliyab na araw ay nagdulot ng matinding init sa buong bayan.

47. Malapit na naman ang pasko.

48. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

49. In addition to his martial arts skills, Lee was also a talented actor and starred in several films, including The Big Boss, Fists of Fury and Enter the Dragon

50. Wag kana magselos, mahal naman kita eh.

Recent Searches

wastesusinagpapaniwalateachmillionscoinbaseperangkumaripasvotesgranmurangadverselyipagbilitenderleytepitakalorenapangalanantunayayonsantosolarsigelintabilaogrammariilangranadabotanteasocomienzancongressbriefpartymodernrabewestlutoanimoycareduongatheringdulotdagligeninyonghimihiyawbagkusanitstudiedpaacommunicationspresspasswordpublishingcandidateadddoonlaylayphysicallatertelefonernag-ugatmakagawaasahanrimasniyangjackzpanggatonglibongsanamaghintaytapatgulatnilaosakininorderadditionallynakapasanegosyantepisitamanawalanpolvosinatupagpara-parangpagkakapagsalitakaibahinimas-himaspnilitnakakadalawnabalitaankumitanagbakasyonnagpakitapauwitobaccopagtiisanpagtataposmamanhikaneskuwelahumahangosnangangaralnagawangkinapanayamnakumbinsiinabutanpaglalabamagdamaganpagdudugomagturonakataaskolehiyomahiyanakikitangkinagatbuwantupelocancerpagtinginkatotohanannapakahabainasikasopagmamanehobumibitiwpinuntahanmangkukulambusinessesmakakakaenmagdaaccessnagpasensiyabilibidnatinagvidtstraktlungsodbinge-watchingpagbibironagtaposnagyayangtatanggapinpumayagminervievitaminbarcelonapalantandaanbarrerasunaniwananpesonakisakaytumindigaustraliapamangkinkulisapawitinamplialilikovariedadsikathinanapmagtanimmanalobinawianlilipad1980pinalakingbobotonapapikitmataasbumangonyamaneleksyontsinelasdisenyotangandespuescolortelefontuvoumalisexpresaninfluencescompletamentecubiclesisidlanorganizegoalmedyonapatinginsumuotpitumponghopenatalongparinviolenceairconvehiclesmartesmapahamaksiga