Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

15 sentences found for "videos,"

1. Creating and monetizing content: You can make money online by creating content, such as videos, podcasts, or blog posts, and monetizing it through advertising, sponsorships, or merchandise sales

2. El internet es una fuente de entretenimiento, como videos, juegos y música.

3. Facebook Live enables users to broadcast live videos to their followers and engage in real-time interactions.

4. Instagram has a "feed" where users can see posts from the accounts they follow, displaying images and videos in a scrolling format.

5. Instagram has introduced IGTV, a long-form video platform, allowing users to upload and watch longer videos.

6. Instagram is a popular social media platform that allows users to share photos and videos.

7. Instagram Stories is a feature that lets users share temporary photos and videos that disappear after 24 hours.

8. Las redes sociales son una plataforma para compartir fotos y videos.

9. She spends hours scrolling through TikTok, watching funny videos and dance routines.

10. También cuentan con pantallas táctiles y una gran cantidad de memoria interna para almacenar información, fotos, videos y música

11. The song went viral on TikTok, with millions of users creating their own videos to it.

12. The TikTok algorithm uses artificial intelligence to suggest videos to users based on their interests and behavior.

13. The TikTok generation is reshaping the way we consume and create content, with short-form videos becoming the new norm.

14. TikTok is a social media platform that allows users to create and share short-form videos.

15. Users can create profiles, connect with friends, and share content such as photos, videos, and status updates on Facebook.

Random Sentences

1. The Tesla Roadster, introduced in 2008, was the first electric sports car produced by the company.

2. Sa pagpanhik ng matanda sa burol ay bumuhos ang malakas na ulan, at yumanig ang lupa.

3. Amazon's revenue was over $386 billion in 2020, making it one of the most valuable companies in the world.

4. Ano ang gustong sukatin ni Merlinda?

5. Good morning, Beauty! aniya sabay halik sa mga labi ko.

6. Omelettes are a popular choice for those following a low-carb or high-protein diet.

7. Tumango ako habang nakatingin sa may bintana, Ok. Sige..

8. Naniniwala ang mga Katoliko na ang mga dasal para sa mga kaluluwa sa purgatoryo ay makakatulong sa kanilang kaligtasan.

9. Naglaba ang kalalakihan.

10. God is often seen as the creator of the universe, with the power to influence and control natural phenomena and human destiny.

11. Nogle helte er kendte for deres modige handlinger under krig.

12. She has been exercising every day for a month.

13. Las hierbas como el jengibre y la cúrcuma tienen propiedades antiinflamatorias y antioxidantes.

14. Eine schwere Last auf dem Gewissen kann uns belasten und unser Wohlbefinden beeinträchtigen.

15. El agricultor contrató a algunos ayudantes para cosechar la cosecha de fresas más rápido.

16. Ano pa ba ang ibinubulong mo?

17. Si John ay isang mabuting kaibigan, datapwat minsan ay napag-uusapan namin ang mga hindi magandang bagay.

18. Get your act together

19. Pinagmamalaki ng mag-asawa ang kanilang anak dahil hindi lang maganda si Lorena kundi ay matalino at may mabuting kalooban din.

20. He was already feeling embarrassed, and then his friends started laughing at him. That added insult to injury.

21. Beauty. si Maico sabay yakap sa akin mula sa likod.

22. He is not typing on his computer currently.

23. Sigurado na siyang walang panalo sa kanya ang matanda.

24. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

25. Limitar la ingesta de alcohol y cafeína puede mejorar la salud en general.

26. Ang pagpapahalaga at suporta ng aking mga kaibigan ay nagpawi ng aking takot at pag-aalinlangan.

27. Todos necesitamos algo en qué creer y esperar en la vida. (We all need something to believe in and hope for in life.)

28. La calidad y la frescura de los productos agrícolas dependen en gran medida de la habilidad y la dedicación del agricultor.

29. Oscilloscopes can be portable handheld devices or benchtop instruments with larger displays and advanced features.

30. Yan ang totoo.

31. Grande is renowned for her four-octave vocal range, often compared to Mariah Carey.

32. Napakagandang dalaga, wika niya sa sarili at tuloy-tuloy na nilapitan niya ito.

33. It's time to pull yourself together and start taking responsibility for your actions.

34. It's important to remember that April Fool's jokes should always be in good fun - nobody likes a prank that's mean or hurtful.

35. I've got a big presentation at work today - I hope I don't break a leg!

36. Pedro at Juan ang mga pangalan ninyo.

37. The Amazon Rainforest is a natural wonder, home to an incredible variety of plant and animal species.

38. Walang 'tayo' Maico. Kaya please lang iwan mo na ako.

39. At ginawaran ng isang matamis na halik ang labi ng naguguluhang si Mariang Maganda.

40. Sila ay nagsisilbing modelo ng katapangan, katapatan, at pagmamahal sa bayan.

41. Pulau Bintan di Kepulauan Riau adalah tempat wisata yang menawarkan pantai yang indah dan resor mewah.

42. Ang pag-asa ay nagbibigay ng mga solusyon sa mga suliranin at hamon na kinakaharap ng mga tao.

43. Napapalibutan ako ng poot habang pinagmamasdan ko ang mga taong nagtataksil sa akin.

44. Magtanim ka nga ng mga puno dyan sa garden.

45. Fødslen er en tid til at fejre og værdsætte kvinders styrke og mod.

46. Las redes sociales son una parte fundamental de la cultura digital actual.

47. They must maintain transparency and communicate with their constituents to build trust and ensure representation is effective.

48. Sweetness can evoke positive emotions and memories, such as childhood nostalgia.

49. Electric cars may require longer charging times than refueling a gasoline-powered car, but advances in battery technology are improving charging times.

50. Rutherford B. Hayes, the nineteenth president of the United States, served from 1877 to 1881 and oversaw the end of Reconstruction.

Recent Searches

manamis-namisnakatunghayvideos,eskuwelahannalulungkotagricultoresmakikipag-duetonagmamaktolmagkakaanakmahabangmaabutanpakakasalancountrydiyaryoenglishnamumulaisinagotnai-dialnangapatdannagbentamangyarikuripotinuulamfactoresnag-emailtatanggapinkaramihanvidenskabnakabibingingdispositivohanapbuhaynapasubsobvideosumagawtamadtiyanperwisyotayosayawanalagaanubayanbagongkumapitinastalayuaneleksyonbumangonshadespagpasokcitypresencehunisidovariedaddisciplinnakabiladnangingitngitydelserbayaningkabilanggobernadorcultivopinag-usapanaeroplanes-allnagsisipag-uwianmagkikitaagwadorpagbabagong-anyopagsasalitatemparaturapakakatandaanmakatulogpagdudugofilipinamawawalanapakahabanapakalusogmagpalagonovellessagasaanmananakawiloilobeautynasiyahanmagtiwalanakakatabagumagamitbulaklakibinibigaykuwadernoihahatidhitangisipartypagkapasoknapaiyaknakuhangmakapagsabiopgaver,turismotatlumpungdisenyongbumisitapamilyangeskuwelalabing-siyamkumikinignauponagkasunogeconomynamulaklakkinauupuangnagsisigawnasasakupansalehitsuranagwelgailongpinapalopagtutolnagtalaganakatagonagmadalinghahatolnaabutannag-aagawanh-hoypagkagustonagmistulanguusapannagreklamodoble-karaflyvemaskineriwinasiwaslumikhabestfriendestudyantenaghuhumindignagtataasminu-minutomakalipasnagpepekegirlkaklaseo-onlinelabinsiyamnakataasbwahahahahahasabihintotoongtumiraninanaisinabutanmakakabalikmagdamaganpamasahekidkiransinasabinapapahintolumamangtumahanmagpagupitvillagetinakasanpahiramlumuwasmakakibonatitiyakproducerersangakainitansamantalangmagbigayanumangtungovedvarendenatanongcombatirlas,hawakkristoisusuotnapilikampanahinanakitbinentahantilgangnakaakyatnaiiritangnatinagtutusinkaliwakampeonnakainomcynthiahistoriamakisuyobinabaratiwanankapwaincitamenter