Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

15 sentences found for "videos,"

1. Creating and monetizing content: You can make money online by creating content, such as videos, podcasts, or blog posts, and monetizing it through advertising, sponsorships, or merchandise sales

2. El internet es una fuente de entretenimiento, como videos, juegos y música.

3. Facebook Live enables users to broadcast live videos to their followers and engage in real-time interactions.

4. Instagram has a "feed" where users can see posts from the accounts they follow, displaying images and videos in a scrolling format.

5. Instagram has introduced IGTV, a long-form video platform, allowing users to upload and watch longer videos.

6. Instagram is a popular social media platform that allows users to share photos and videos.

7. Instagram Stories is a feature that lets users share temporary photos and videos that disappear after 24 hours.

8. Las redes sociales son una plataforma para compartir fotos y videos.

9. She spends hours scrolling through TikTok, watching funny videos and dance routines.

10. También cuentan con pantallas táctiles y una gran cantidad de memoria interna para almacenar información, fotos, videos y música

11. The song went viral on TikTok, with millions of users creating their own videos to it.

12. The TikTok algorithm uses artificial intelligence to suggest videos to users based on their interests and behavior.

13. The TikTok generation is reshaping the way we consume and create content, with short-form videos becoming the new norm.

14. TikTok is a social media platform that allows users to create and share short-form videos.

15. Users can create profiles, connect with friends, and share content such as photos, videos, and status updates on Facebook.

Random Sentences

1. Pasensya naman, anak rubber shoes ako eh.

2. Ang carbon dioxide ay ina-absorve ng mga puno.

3. Si Rizal ay kilala sa kanyang pagiging makatarungan at pagiging boses ng mga walang tinig sa kanyang panahon.

4. Oo, kinanta 'to sakin ng isang babaeng kinaiinisan ko...

5. Naghahanap ako ng mga chord ng kanta ng Bukas Palad sa internet.

6. Con paciencia y perseverancia todo se logra.

7. Lalong pinagsikapan ng paring Kastila ang pagtuturo ng buhay at mga aral ni HesuKristo.

8. Sa takip-silim, mas mahimbing ang tulog dahil sa kalmado at malamig na panahon.

9. James K. Polk, the eleventh president of the United States, served from 1845 to 1849 and oversaw the Mexican-American War, which resulted in the acquisition of significant territory for the United States.

10. Ipinakita ng dokumentaryo ang mga kaso ng abuso sa mga nakakulong na bilanggo.

11. Ang pagtitiyak ng seguridad sa mga border at mga pantalan ay mahalaga upang maiwasan ang pagpasok ng mga illegal na droga sa bansa.

12. Esta salsa es dulce y picante al mismo tiempo.

13. Es importante tener en cuenta que el clima y el suelo son factores importantes a considerar en el proceso de cultivo del maíz

14. It has revolutionized the way we communicate and has played a crucial role in shaping modern society

15. Siguro nga isa lang akong rebound.

16. The hospital had a special isolation ward for patients with pneumonia.

17. Hospitalization can increase the risk of developing infections, and patients may be isolated or placed in quarantine if necessary.

18. The telephone has undergone many changes and improvements since its invention, and it continues to evolve with the rise of mobile phones

19. Ang mga dahon ng bayabas ay nagagamit din sa medisina.

20. Nahawa ako ng kuto sa kapatid ko.

21. Sa bawat panaghoy ng mga ina, umaasa silang magkakaroon ng katarungan ang kanilang mga anak.

22. Babalik ka pa ba? nanginginig na yung boses niya

23. Omelettes are a popular choice for those following a low-carb or high-protein diet.

24. Aling hayop ang nasa tabi ng puno?

25. Di ko sya maistorbo dahil sya ay nag-aaral pa.

26. May lumabas umanong bagong sakit na dapat pag-ingatan ng publiko.

27. Les impôts sont une source importante de revenus pour l'État.

28. Naging mas makapal nga ang buhok ni Rabona.

29. She enjoys cooking a variety of dishes from different cultures.

30. The beach has a variety of water sports available, from surfing to kayaking.

31. Nationalism can also lead to xenophobia and prejudice against other nations and cultures.

32. Bagaimana cara memasak nasi yang enak? (What is the recipe for cooking delicious rice?)

33. She reads books in her free time.

34. While it has brought many benefits, it is important to consider the impact it has on society and to find ways

35. Me gusta mucho dibujar y pintar como pasatiempo.

36. Les écoles travaillent à fournir un environnement d'apprentissage sûr et inclusif pour tous les étudiants.

37. Magkano ang isang kilo ng mangga?

38. Hindi mapigil ang pagkakatitig niya sa pagkain na naglalaway na sa harap niya.

39. Elle adore les films d'horreur.

40. Tulad ng dati ay araw araw siyang sumusulat kay Helena ngunit bihira ng sumagot ang dalaga sa mga sulat niya.

41. No deberías estar llamando la atención de esa manera.

42. Tesla's vehicles are equipped with over-the-air software updates, allowing for continuous improvements and new features to be added remotely.

43. Gusto ko hong pumunta sa Pearl Farm.

44. Samantala sa pagtutok sa kanyang mga pangarap, hindi siya nagpapatinag sa mga hamon ng buhay.

45. Ang kaniyang ngiti ay animo'y nagbibigay-liwanag sa madilim na kwarto.

46. Puwedeng gamitin ang pagguhit upang mag-drawing ng mga bagay na gusto mong ma-achieve sa buhay.

47. Hindi ko alam kung kakayanin ko, pero sana pwede ba kitang mahalin?

48. El invierno es una de las cuatro estaciones del año.

49. Sino-sino ang mga pumunta sa party mo?

50. The uncertainty of the weather has led to the cancellation of the outdoor event.

Recent Searches

videos,medya-agwapakikipagtagpobumisitalabing-siyamnagmamadalinakapapasongkalaunanhitayumabongnagcurvepaki-drawingmahihirapinsektonghumiwalaypaglisaniintayinmahiyafitnessnovellesbeautybulaklaknasilawsangapumayagintensidadtindaabundanteumakbayhawakpwestonagsineproyektomag-ingatnabiglapneumoniatalagangsumasayawpanginoonminamasdanmatangumpaynapabantulotsisentademocraticsalitangkasalnaturalpromotebisikletahigh-definitionmalikotfathersusinaggalatagalogsonidohvernag-replypagbatifallnagbasabangkongipaliwanagbarrocomapaibabawparangsawabilinorugachadlayasshopeelutobilhinfakeutilizansumamaexampaanocoachingprofessionalimaginationcebumapaikotlivebigauditeveningenchantedconnectionbroadcesfacilitatinghelpfulthirdinternalpeterthanksgivingpakealamsellingnagbibirosupplyprogrammingbasahaninfectiouscareerbarorektanggulokastilaresultaalisnganapakahabausoremembermagkikitanangagsipagkantahannag-oorasyonhinawakanmalilimutanmakikipag-duetonalulungkotnapakatagalnagkitanagbabakasyonpagkakatayohubad-barokinagalitanmaihaharapmakikipagbabagnapapatungolumalakiressourcernepinapakiramdamanhampaslupanagreklamonaghuhumindigentrancekare-karenahuhumalingtatlumpungmaglalaropagbabayadincluirmangahasengkantadangmagkasamamensaheencuestashayaanpasaherotumamataosmaskinernamuhaydaramdaminmaliwanagpinasalamatantravelpinuntahankabundukanpagtataasnag-aagawanhurtigerekilongnakalockkumirottumalonpartsibinigaypumilinapahintobutikikapaligirankagyatmaasahanintramurosisinusuotperyahankisapmatapundidopalasyoumibigbungapaladhinanakitgawadisentesampaguitapitokanayanghidingnagniningningnuevospa-dayagonalpinagkaloobanmaongnatutulogbaryo