Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

2 sentences found for "hiding"

1. Haha! Who would care? I'm hiding behind my mask.

2. I played an April Fool's prank on my roommate by hiding her phone - she was so relieved when she found it that she didn't even get mad.

Random Sentences

1. Dalawa ang kalan sa bahay namin.

2. May anak itong laging isinasama sa paglalaba.

3. Platforms like Upwork and Fiverr make it easy to find clients and get paid for your work

4. Tomar decisiones basadas en nuestra conciencia puede ser difícil, pero a menudo es la mejor opción.

5. Coffee can be prepared in a variety of ways, including drip brewing, espresso, and French press.

6. Emphasis can help to ensure that a message is received and understood by the intended audience.

7. Hey! Wag mo ngang pakealaman yan! sigaw ko sa kanya.

8. Limitations can be a source of motivation to push oneself to achieve more.

9.

10. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

11. Lügen haben kurze Beine.

12. El nacimiento de un bebé es un recordatorio de la belleza de la vida.

13. The field of entertainment has also been greatly impacted by technology

14. Mas mainit ang panahon kung walang hangin.

15. Alam ko na may karapatan ang bawat nilalang.

16. El agua es utilizada en diversas actividades humanas, como la agricultura, la industria y el consumo doméstico.

17. Nagreport sa klase ang mga grupo nang limahan.

18. She has excellent credit and is eligible for a low-interest loan.

19. As your bright and tiny spark

20. Jennifer Lawrence won an Academy Award for her role in "Silver Linings Playbook" and is known for her performances in the "Hunger Games" series.

21. I don't eat fast food often, but once in a blue moon, I'll treat myself to a burger and fries.

22. They go to the gym every evening.

23. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Ang bawat paaralan ay nag-aapuhap ng mga donasyon para sa bagong aklat at kagamitan ng kanilang mga mag-aaral.

25. La conciencia puede hacernos sentir culpables cuando hacemos algo que sabemos que está mal.

26. Sa aming klase, tinalakay namin ang iba't ibang anyo ng panitikan ng Pilipinas, at ito ay nagbibigay daan sa mas malalim na pag-unawa sa buhay.

27. Ano ang ininom nila ng asawa niya?

28. Ang pagbasa ng mga positibong pananaw at inspirasyonal na mga salita ay nagdudulot sa akin ng isang matiwasay na pananaw sa buhay.

29. Limiting alcohol and caffeine intake can improve overall health.

30. Sa aksidente sa kalsada, maraming tao ang nasugatan at ilang pasahero ang namatay.

31. Ang mga palaisipan ay maaaring may iba't ibang antas ng kahirapan, mula sa simpleng tanong hanggang sa mga mas komplikadong suliranin.

32. Jack and the Beanstalk tells the story of a young boy who trades his cow for magic beans.

33. Who are you calling chickenpox huh?

34. The legend of Santa Claus, a beloved figure associated with Christmas, evolved from the story of Saint Nicholas, a Christian bishop known for his generosity and kindness.

35. Pardon me, but I don't think we've been introduced. May I know your name?

36. ¿Quieres algo de comer?

37. Matapos ang matagal na relasyon, napagpasyahan niyang mag-iwan at mag-move on.

38. Nakatulog ako sa harap ng telebisyon at nagitla ako nang biglang nagtaas ang boses ng mga artista sa palabas.

39. Dette skyldes, at den offentlige regulering sikrer, at der er en vis grad af social retfærdighed i økonomien, mens den frie markedsøkonomi sikrer, at der er incitamenter til at skabe vækst og innovation

40. Twinkle, twinkle, little star.

41. Estoy sudando mucho. (I'm sweating a lot.)

42. Don't beat around the bush with me. I know what you're trying to say.

43. Sa hirap ng sitwasyon, nangahas siyang humingi ng tulong mula sa mga estranghero.

44. Les prêts sont une forme courante de financement pour les projets importants.

45. Una niyang binasa ang batok---kaylamig at kaysarap ng tubig sa kanyang batok.

46. Les investissements peuvent générer des rendements significatifs, mais comportent également des risques.

47. Limitations can be addressed through education, advocacy, and policy changes.

48. Sweeteners are often used in processed foods to enhance flavor and extend shelf life.

49. Actions speak louder than words.

50. Ailments can be a result of aging, and many older adults experience age-related ailments, such as arthritis or hearing loss.

Recent Searches

hidingtrabajarrambutankerbbangasimtinylagisumugodsumindimovingsang-ayonmaramingdalawinbibilhinsongsgloriaginamitmaghatinggabiobservation,teachingskirbynatitirangawitannangingisaypinagtagponanghihinamadnagtatrabahopinagsikapansponsorships,kinalakihanmanggagalingbloggers,pagkahaponagsisigawerhvervslivetpagngitisalenagpapaigibmagpaniwalaikinabubuhaygratificante,nailigtasmananakawtaun-taonibinibigaybefolkningen,householdsh-hoypamilihanmaliksinakayukopumapaligidnapalitangnagawangpagguhitpuntahanpumulotkulungankinumutanpawiinmasasayagumawanapapahintopaalamcramebinitiwankailanmantinanggalpapalapithagdanansalaminkakilalatutusinnapiliminsannangalaglagnakikini-kinitagreatlysellingkasuutandialledamendmentssalatinexperience,palapagkamalayannilalangyourself,binataklegacyhomekuyacarolbalotreviewmatamanmaayosnararapatparotanodcomputere,tsakatupelomalakihumblehvermalihispasigawmeansandamingbabesyepgamotpinatidsangsilbingvehicleslegislationeffektivcelularesnilabotesinabiunderholdersumakitangkopshortideasbobokatabingsumabogownmedievalgenerationershockgameputaheworrymapakalidahonstevesinongnathanpookbroadcastspasinghalheftyrepresentedimpacted1982corneritinuringbehindlangresponsiblepinapasayadanskesementongkalyekumalmajackypedenaglalakad1970sdayspuwedengdisciplinpagkakatuwaanmaliniswarinagsisipag-uwianhinimas-himasflyvemaskinerumokaymamalastaon-taonalagaberetisandwichnatutokpagkatapositinaobcharmingmataraytextoanimpagmamanehodapit-haponitosarisaringfranciscoperpektingdumatingemocionesbayaningsinungalingsinaexamnagkakamali