Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

6 sentences found for "civilization"

1. But the point is that research in the field of the development of new energy sources must be carried on further and expedited so that the exhaustion of conventional sources of power does not adversely affect the growth of our economy and the progress of civilization

2. In the last three hundred years, many human efforts have been spent in search of sources of energy-coal, petroleum, and power generated from water which will maintain the present rhythm of civilization unchecked

3. Modern civilization is based upon the use of machines

4. The Machu Picchu ruins in Peru are a mystical wonder of the ancient Inca civilization.

5. The Pyramids of Chichen Itza in Mexico are an impressive wonder of Mayan civilization.

6. Throughout history, technology has played a vital role in shaping human civilization and has had a profound impact on society

Random Sentences

1. Hindi ako sang-ayon sa pag-uugali ng ilang mga kabataan ngayon.

2. Puwede ba akong sumakay ng dyipni?

3. Ang kalangitan ay nagbabaga sa pulang liwanag ng dapithapon.

4. Para cosechar la miel, los apicultores deben retirar los panales de la colmena.

5. Binabasa ng mga mag-aaral ang talambuhay ni Emilio Aguinaldo para mas maunawaan ang kasaysayan ng Pilipinas.

6. Matagal ko nang nararamdaman ang mga ito, kaya sana pwede ba kita ligawan?

7. The United States has a national motto, "In God We Trust," and a national anthem, "The Star-Spangled Banner."

8. Ano ka ba Beast! Bumitaw ka nga, ang daming tao oh.

9. Baby fever is a term often used to describe the intense longing or desire to have a baby.

10. Drømme kan være en kilde til kreativitet og innovation.

11. These films helped to further cement Presley's status as a cultural icon and helped to solidify his place in the history of American entertainment

12. Inflation kann die Preise von Vermögenswerten wie Immobilien und Aktien beeinflussen.

13. In Spanish cuisine, a tortilla española is a thick omelette made with potatoes and onions.

14. Ang dami daw buwaya sa kongreso.

15. En el siglo XVII, el Barroco español produjo figuras importantes como Francisco Guerrero y Tomás Luis de Victoria

16. Bawal ang maingay sa library.

17. Tesla's goal is to accelerate the world's transition to sustainable energy and reduce reliance on fossil fuels.

18. Wala ho akong dinukot na maski ano sa kanya.

19. Mayroong proyektor sa silid-aralan upang mas maipakita ang mga visual aids sa pagtuturo.

20. Wag mo na akong hanapin.

21. Nagpamasahe ako sa Boracay Spa.

22. Taking part in an activity that you are passionate about can create a sense of euphoria and fulfillment.

23. Hindi lahat ng ating mga pangarap ay madaling makamit, kaya't kailangan nating magpakatatag.

24. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

25. Sa aming mga paglalakbay sa malalayong lugar, natutuwa kami sa mga disenyong mayabong ng mga hardin at parke.

26. Hindi na nakarating ang mensahe ni Andy sa kanyang ina.

27. Les investissements peuvent générer des rendements significatifs, mais comportent également des risques.

28. Inflation kann auch durch externe Faktoren wie Naturkatastrophen verursacht werden.

29. At leve med en tung samvittighed kan føre til søvnløshed og andre sundhedsproblemer.

30. Nasa ilalim ng mesa ang payong.

31. Está claro que debemos tomar una decisión pronto.

32. Kapag tag-araw ay malaki-laki rin ang kinikita ng mga agwador.

33. Practice makes perfect.

34. Después de terminar el trabajo, fuimos a celebrar con nuestros amigos.

35. Napatingin ako sa may likod ko.

36. Les personnes qui ont une passion pour ce qu'elles font sont souvent plus motivées à y consacrer leur temps et leur énergie.

37. Nakita niyo po ba ang pangyayari?

38. Ituturo ni Clara ang tiya niya.

39. Nahihilo ako dahil masyadong mainit ngayon.

40. Quiero contribuir a la protección del medio ambiente y hacer del mundo un lugar mejor para vivir. (I want to contribute to the protection of the environment and make the world a better place to live.)

41. Pakibigay na lang ang mensahe ko kay Miguel kung hindi ko siya maabutan.

42. Itim ang gusto niyang kulay.

43. "Masaya ako na nakilala kita," ani ng bagong kaibigan ko.

44. The bag of groceries was too hefty for the elderly woman to carry on her own.

45. Madalas na mayroong mga organisasyon na nagsusulong ng kapayapaan at pagtigil ng digmaan.

46. ¿Te gusta la comida picante o prefieres algo más suave?

47. To break the ice with a shy child, I might offer them a compliment or ask them about their favorite hobbies.

48. They have been playing tennis since morning.

49. Los sueños son la semilla de nuestras acciones y logros. (Dreams are the seed of our actions and achievements.)

50. El momento del nacimiento marca el inicio de una nueva etapa en la vida de los padres.

Recent Searches

civilizationexcusecupidpagodomgbigotebilugangmakipag-barkadanaguguluhangnakalilipasagam-agamsaleyeynagtatanongkapangyarihangalikabukinadmiredduonubonagsisipag-uwiannakapagngangalitculturakumembut-kembotmakikikainflyvemaskinerpagmamanehonagawangmakasilongpamilyangpinapasayatumahimikpagbahingdyipnaglulutodispositivohayaangpaghahabipaghaharutansulyapnovelleshahatolsakenbayanikalabanumokaybintanaparusahankasohinanakitiyamotnakapapasongoxygenbunutanmaramotipinambiliadvertisingmatulunginkauntigawingakmangsumusulatilocosbalanglinawlenguajepanindangpeppymatarayhoymasipagbumababawarivalleymaduraspaghinginiligawananiyacomputere,yatabusystrategytextocadenapedebarriersjackymajorformasreducedmonetizingeverywayslimitpopulationfatalareabosesoftedoble-karatawanantrasciendehagdanandilagsomethingincludewhetherwithoutandremonitormaratingrinjohntatawagarturocommercialsuotmartiankahuluganglobalabalasystematisk1982exhaustedgayundinnag-usapsurgeryincreasinglypinagkiskisinvestubuhinaksidentemasayakutiskalarodiversidadpakakasalanlayastoretesiyamagagandangprogrammingedit:evolvelabibiyernesjunionakapasaejecutarsamahaniligtasinakyatoncerimasmakisigpumatolpinagsanglaansocialehoweverumibigginisingteknologiinuulamnasasalinanvibratecutsharknakangitilisteninghenrymasayang-masayacapableipinansasahognagpatimplakeepingyeheyoutlinesmabangongtimeinilabaspinapakainnag-emailnapadungawmamitascarolreaderstingnanmorningmakapagmanehoimprovetinatanongpromotenapakaramingmarketingkaninonghumabolhelphearthanggangemailbasa