Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

6 sentences found for "civilization"

1. But the point is that research in the field of the development of new energy sources must be carried on further and expedited so that the exhaustion of conventional sources of power does not adversely affect the growth of our economy and the progress of civilization

2. In the last three hundred years, many human efforts have been spent in search of sources of energy-coal, petroleum, and power generated from water which will maintain the present rhythm of civilization unchecked

3. Modern civilization is based upon the use of machines

4. The Machu Picchu ruins in Peru are a mystical wonder of the ancient Inca civilization.

5. The Pyramids of Chichen Itza in Mexico are an impressive wonder of Mayan civilization.

6. Throughout history, technology has played a vital role in shaping human civilization and has had a profound impact on society

Random Sentences

1. Setiap orang memiliki definisi kebahagiaan yang berbeda-beda.

2. May gusto lang akong malaman.. I have to ask him.

3. Dapat nating linisin ang mga kubyertos bago natin gamitin.

4. Chumochos ka! Iba na pag inlove nageenglish na!

5. The company's financial statement showed an increase in acquired assets.

6. Halos hindi niya narinig ang halingling ni Ogor.

7. Nakatingin silang lahat sa amin, Sabay kayong maliligo?!?!

8. Maiba ako Ikaw, saan ka magpa-Pasko?

9. May meeting daw ang lahat ng guro kaya't kami ay maagang pinauwi.

10. Sabi ng mga teologo, ang pag-aari ng simbahan ay nagbibigay kaligtasan sa mga kaluluwa mula sa purgatoryo.

11. Minsan ay isang diwata ang nagpanggap na isang babaeng madungis.

12. Iginitgit ni Ogor ang bitbit na balde at kumalantog ang kanilang mga balde.

13. Nagluto ng pansit ang nanay niya.

14. The United States is a representative democracy, where citizens elect representatives to make decisions on their behalf

15. Lumiwanag ang mukha ni Ana nang makita ang resulta ng exam.

16. Las plantas trepadoras, como las enredaderas, utilizan estructuras especiales para sujetarse y crecer en vertical.

17. Tanghali na nang siya ay umuwi.

18. In conclusion, making a book is a creative and fulfilling process that requires planning, research, and hard work

19. Lumapit sakin si Kenji tapos naka smile siya.

20. Hindi dapat magbigay ng halaga sa mga kababawang bagay tulad ng kasikatan o kasikatan ng mga gamit.

21. Les enseignants doivent collaborer avec les parents et les autres professionnels de l'éducation pour assurer la réussite des élèves.

22. Some people have a sweet tooth and prefer sweet flavors over others.

23. Ang guro ko sa heograpiya ay nakatulong sa akin upang maunawaan ang kahalagahan ng mga kalupaan at karagatan.

24. Naging masaya ang aking buhay dahil sa aking mga kaulayaw.

25. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

26. Las serpientes son animales de sangre fría, lo que significa que dependen del ambiente para regular su temperatura corporal.

27. I woke up to a text message with birthday wishes from my best friend.

28. Ang pamilya ang sandigan sa oras ng kagipitan.

29.

30. Investors with a lower risk tolerance may prefer more conservative investments with lower returns but less risk.

31. Les personnes endettées peuvent se retrouver dans une situation financière difficile.

32. Ito ay pinangalanang Hari ng Karagatan na walang takot kaninuman.

33. Ang nagdudumaling helicopter ay masigla na naglilipad sa himpapawid.

34. The invention of the motion picture camera and the development of television and video games have provided new forms of entertainment for people of all ages

35. Dapat natin kontrolin ang pagmamalabis sa paggamit ng social media upang hindi ito makaapekto sa ating mental na kalusugan.

36. At følge sin samvittighed kan være afgørende for at træffe de rigtige beslutninger i livet.

37. Reden ist Silber, Schweigen ist Gold.

38. Las hierbas silvestres crecen de forma natural en el campo y se pueden utilizar en infusiones.

39. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

40. Isinaboy niya ang tubig na nasa harap.

41. Las hojas del libro están todas marcadas con notas adhesivas.

42. Umulan man o umaraw, darating ako.

43. Lagi na lamang itong nag fe-facebook.

44. Nakatanggap umano siya ng isang liham mula sa isang taong matagal nang nawala.

45. Sa mga perya, naglipana ang mga tao na naghahanap ng libangan.

46. Ang mga sumusunod na salita ang nagsasabing siya ay pulubi.

47. Anong oras ho ang dating ng jeep?

48. As technology continues to advance, it is important to consider the impact it has on society and to find ways to mitigate any negative effects while maximizing its benefits

49. Climbing to the top of a mountain can create a sense of euphoria and achievement.

50. Disyembre ang paborito kong buwan.

Recent Searches

developcivilizationtwo-partyisipasimmakasilongmanakboisulatpaglalayagemocioneshinamaktindahanpaaralanhumihingimbricosgagamitniyogbutimagalitbirthdaybighanipadalase-commerce,magisingtinikmantalinosteamshipstalagangxviipumikithiramniyonawitankalaroconvey,umuposandwichskillsnatatanawconclusion,promisetagumpaytiniklinggawingisinamatelephonechristmasbumalikbanalestadoskundimangumisingmabibingiriegabinabaratbook,observation,undeniablekumainkatibayangbiglaanincredibleeconomicherramientastagalgustongvegassahigdyosasementobawatsocietymahigpitperseverance,tuwidgandacontent,lungsodahhhhpangakovariedadhinampasnapahallayonmalayabiggestmalinisheymensajespagkakapagsalitapapuntakayang-kayangadvertising,gabi-gabitinatawagnag-aalangannananaginippagka-maktolnalulungkotkadalagahangmagpa-checkupnapakatagalpaglapastanganiloilopagsisisicrucialpagpilibumibitiwmakapalagnegro-slavesinvestingnakikianandayanalakiaplicacionesmawawalanovellespagkasabipambahaykatuwaanstrategiespanalanginngpuntaleaderspacienciapinagawamedikalproductividadforskel,nakakatandanangangalitairportkahuluganmatagpuanmedicaldiwatasinasabimanatiliarbejdsstyrkemakikituloggumawamakakibohayaanpinapataposmakaraanpawiindisfrutarsinaliksikseguridadumuwimagpagupittangeksmakasalanangyakapinactualidadumakbayasawaimportantenapapansintumiranami-misstumalimmaipapautanglinggongkisspamilyaclientesstylesresourcesdarkmichaelsarilingissuesserabslivebagipagtimplacorrectingstatepowersbadingmonetizingroquesteerdebateswouldbehindevensomecornerincreasedstoplightbeforeevilthemapollorawslave