Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

8 sentences found for "film"

1. Ariana is also an accomplished actress in film, with roles in movies like Don't Look Up (2021).

2. Bagaimana pendapatmu tentang film yang baru saja tayang? (What is your opinion on the latest movie?)

3. Emma Stone won an Academy Award for her role in the film "La La Land" and has appeared in movies like "The Help" and "Easy A."

4. For eksempel kan vi nu få adgang til tusindvis af film og tv-shows på vores telefoner og computere, og vi kan styre vores hjem med en app på vores telefon

5. Hugh Jackman is best known for his portrayal of Wolverine in the "X-Men" film series and his Tony Award-winning performance in the musical "The Boy from Oz."

6. I don't usually go to the movies, but once in a blue moon, there's a film that I just have to see on the big screen.

7. Los Angeles is considered the entertainment capital of the world, with Hollywood being the center of the film and television industry.

8. The film director produced a series of short films, experimenting with different styles and genres.

Random Sentences

1. Ein frohes neues Jahr! - Happy New Year!

2. Sa bawat panaghoy ng mga ina, umaasa silang magkakaroon ng katarungan ang kanilang mga anak.

3. Umalis sa sakayan ang mga pasahero nang limahan.

4. Ang nakita niya'y pangingimi.

5. Nasurpresa ako ng aking mga kaibigan sa aking kaarawan kaya masayang-masaya ako ngayon.

6. Ano?! Diet?! Pero tatlong plato na yan ah.

7. Naglalaway ang mga bata sa tuwing nakakakita ng mga kendi at tsokolate.

8. Ang paggamit ng droga ay maaaring magdulot ng mga epekto sa pag-iisip, emosyon, at pisikal na kalusugan ng isang tao.

9. Eh kelan niyo ba balak magpakasal?

10. Je suis en train de manger une pomme.

11. Kapag niluluto ni Tatay ang adobo, ang amoy ay sobrang mabango at nakakagutom.

12. Consumir una variedad de frutas y verduras es una forma fácil de mantener una dieta saludable.

13. Nagtatanim ako ng mga bulaklak sa mga paso upang magkaroon ng mga colorful na dekorasyon sa loob ng bahay.

14. Ang pagkakaroon ng maayos na usapan ay nagpawi ng mga alinlangan sa pagitan naming mag-asawa.

15. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

16. Hindi na natapos ang aming hiking dahil sa biglang pagdidilim ng kalangitan.

17. The bird sings a beautiful melody.

18. La pimienta cayena es muy picante, no la uses en exceso.

19. Sino-sino ang mga inimbita ninyo para manood?

20. Electric cars may require longer charging times than refueling a gasoline-powered car, but advances in battery technology are improving charging times.

21. Hinagud-hagod niya ang mga kamao.

22. Einstein's most famous equation, E=mc², describes the relationship between energy and mass.

23. George Washington was the first president of the United States and served from 1789 to 1797.

24. Aanhin ko 'to?! naiiritang tanong ko.

25. Stock market investing carries risks and requires careful research and analysis.

26. AI algorithms can be trained using large datasets to improve their accuracy and effectiveness.

27. Nagkakaroon ng pagdiriwang sa Batangas tuwing ika-23 ng Hulyo sa pag-alala kay Apolinario Mabini.

28. Ang aming angkan ay nagpapahalaga sa pagiging matapat sa mga relasyon.

29. The sun sets in the evening.

30. Deep learning is a type of machine learning that uses neural networks with multiple layers to improve accuracy and efficiency.

31. Despite the many advancements in television technology, there are also concerns about the effects of television on society

32. Magtatapos ako ng aking thesis sa buwan na ito, datapwat kailangan kong maglaan ng mas maraming oras para dito.

33. Ang tubig-ulan ay maaaring magdulot ng pagpapakalma at kapanatagan sa mga tao dahil sa tunog ng ulan at sariwang hangin.

34. Les enseignants doivent collaborer avec les parents et les autres professionnels de l'éducation pour assurer la réussite des élèves.

35. They offer rewards and cashback programs for using their credit card.

36. Ang nagbabago ay nag-iimprove.

37. Los ríos y lagos son fuentes importantes de agua dulce.

38. Ibinili ko ng libro si Juan.

39. Kapag may tiyaga, may nilaga.

40. Pardon me, but I don't think we've been introduced. May I know your name?

41. Ang mailap na impormasyon ay kailangan pag-aralan ng mabuti upang maiwasan ang pagkakamali.

42. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

43. Investment strategies can range from active management, in which an investor makes frequent changes to their portfolio, to passive management, in which an investor buys and holds a diversified portfolio over the long term.

44. Magsabi ka ng totoo, kung di ay dadalhin kita.

45. Les employeurs peuvent utiliser des méthodes de travail flexibles pour aider les travailleurs à équilibrer leur vie professionnelle et personnelle.

46. Hindi ka puwedeng pumasok sa unibersidad.

47. Maingat na nangampanya ang mga kandidato ayon na rin sa alituntunin ng IATF.

48. Kaya kahit nang dalhin ko siya sa isang karnabal, isa lamang ang ninais niyang sakyan.

49. Humayo ka at hanapin mo ang dalagang sinasabi ko para mabalik ang dati mong anyo, ang utos ng engkantadang babae.

50. Hindi ko matatanggap ang kanilang panukala dahil mayroon akong mga reservations dito.

Similar Words

films

Recent Searches

artistfilmnagpakitapartybibilhinkamandagcombatirlas,erlindabulalas1960sdeliciosapamburaanamataposshadespinangalananmegetworkshopyamanlamanhapagmagkakaanaksaidstoinastakasamaanglatekagipitanperwisyopusahalu-haloeffektivkampeonhulihanrelohumanoskaedadparthahahasupilinexpeditedhinatidebidensyalimitsadyangnagpepekehoyvalleykulangpagtinginboksingpagkagustolalakipetsapagtataposnabigyanestudyantelabisbinatakmournedbuwalrelativelybroadcriticsnatayoapoynakakapamasyalinalalanapadaanmaabutanisulatmagkipagtagisanconvey,isinalaysaynangangaralhighestlalargapakibigaycornersasayawinrepresentedgagamitinuminpagtatanimtungawutilizamakabawikaklasemaestroblazingnowtaongeuphorickagalakanvelfungerendemagpaniwalautilizarandamingunoslamesajosedisfrutartatayoklasengmagsusuotmagbigayanmaaringpopcornbadbumotoproductskinamumuhianitongpinaladmagsimulalibagumarawwhytapelatestinimbitaupworkitemsuniversitynagtuturotumunognakapikitrailindustriyapigainprogressautomationfaultsettingnapapansintypeslumabasconditionoffentliglasingwriting,currente-booksdatajuanitomanakbofederalwebsiteanongnapakatalinosalbaheveryuulitinnamumulotitinaobsantoknowsundalodegreespinapanoodkirotpiratasumarapdisenyongsedentaryipagtimplaborgerekapwacrosshousenakakagalingsubjectnaririnigpumapaligidnahigitanculturamalumbaytinatanongmabaitkabundukandisyempresambitcompostnaturalkagandatsepaki-basaasalnababasakatienapipilitanexecutivesunud-sunodtuyotbinilinaidlipsiyangeasykanyagusto