Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "bibisita"

1. Bibisita ako sa lola ko sa Mayo.

Random Sentences

1. Nagsagawa ang pulisya ng mga raids sa mga tahanan ng mga kilalang salarin sa lugar.

2. Drømme kan inspirere os til at være vores bedste selv og opnå vores fulde potentiale.

3. Nalugi ang kanilang negosyo.

4. Habang nagluluto, nabigla siya nang biglang kumulo at sumabog ang kawali.

5. Hinahanap ko si John.

6. The Lakers have a large and passionate fan base, often referred to as the "Laker Nation," who show unwavering support for the team.

7. Kadarating mo pa lamang, Ogor, nais niyang itutol.

8. Si Jeny ay bigong manalo bilang presidente ng kanilang paaralan.

9. Nasaan ang Katedral ng Maynila?

10. El agua es utilizada en diversas actividades humanas, como la agricultura, la industria y el consumo doméstico.

11. Børn har brug for tryghed, kærlighed og omsorg for at udvikle sig optimalt.

12. Baby fever can affect people of various ages, backgrounds, and genders.

13. In addition to his musical career, Presley also had a successful acting career

14. At habang lumalaki na nga ang bata ay unti-unti itong naging bihasa sa paghahabi ng mga tela.

15. The telephone has undergone many changes and improvements since its invention, and it continues to evolve with the rise of mobile phones

16. Mabuti na lamang at hindi natuloy ang sumpa.

17. Balancing calorie intake and physical activity is important for maintaining a healthy weight.

18. Después de hacer la compra en el supermercado, fui a casa.

19. Jennifer Lawrence won an Academy Award for her role in "Silver Linings Playbook" and is known for her performances in the "Hunger Games" series.

20. ¿Qué edad tienes?

21. Las hojas de los cactus son muy resistentes y difíciles de cortar.

22. Sayur asem adalah sup sayuran dengan bumbu yang asam dan pedas.

23. Tumindig ang pulis.

24. Las redes sociales pueden ser adictivas y consumir mucho tiempo.

25. Ang mga ulap ay nagdulot ng pagdidilim sa buong lugar, kaya't mas nahihirapan akong makita ang aking mga kasama.

26. A lot of noise from the construction site disturbed our peace and quiet.

27. Emphasis can be used to create a memorable and impactful message.

28. God is often seen as the creator of the universe, with the power to influence and control natural phenomena and human destiny.

29. Omelettes are a popular choice for those following a low-carb or high-protein diet.

30. Pumupunta ako sa Laguna tuwing Mayo.

31. It has been found that by abstaining from smoking a person may be cured of many diseases

32. Arbejdsgivere leder ofte efter erfarne medarbejdere.

33. La habilidad de Da Vinci para dibujar con gran detalle y realismo es impresionante.

34. Musk has been described as a visionary and a disruptor in the business world.

35. Sa tamis na dulot ng pag-ibig natin dalawa.

36. Ano kaya ang pakiramdam ng nakasakay sa eroplano.

37. Using the special pronoun Kita

38. Les scientifiques travaillent ensemble pour résoudre des problèmes complexes.

39. Marami ang dumarayo hindi lamang para bumili ng mga disenyo kundi upang makita rin ang paggawa ng bata.

40. Ang mga puno at halaman ay nag po-produce ng oxygen.

41. The dedication of scientists and researchers leads to groundbreaking discoveries and advancements in various fields.

42. Hanggang sa dulo ng mundo.

43. The success of Tesla has had a significant impact on the automotive industry, inspiring other automakers to invest in electric vehicle technology and develop their own electric models.

44. El cultivo de hortalizas es fundamental para una alimentación saludable.

45. Walang anak sina Mang Kandoy kaya't ganoon na lamang ang dasal nila sa Panginoon upang mabigyan sila ng anak.

46. Patients are usually admitted to a hospital through the emergency department or a physician's referral.

47. Hindi siya makapagtaas ng mabibigat dahil mababa ang kanyang timbang.

48. Mabibingi ka sa ingay ng kulog.

49. A penny saved is a penny earned

50. Initial coin offerings (ICOs) are a means of raising capital through cryptocurrency crowdfunding.

Recent Searches

bibisitabairdisipanminamahallabingmakingmasungitinteriornaiilagansapatoslikod1929ilanshowsnahawatransmitsgoodgrowthsaan-saanmagitinaobisasamaednamamasyalspaghettinatuloygawingdaladalabasketsumangkartonagosmuntikanvenusetsycantocontent:maanghanghierbasmaratingaddpoorernakalilipastatawagnabalitaanpagngitinagtitindapilipinogumawapaglapastanganpagkabiglamagkaibangpupuntahankasyamamalasmanahimikistasyonpagsubokmanatilibrancher,nataposbrasoninongandresbalatbestidaorganizeusingnutsthreenevernagawangnalagutanmakidalohinimas-himasnakasandignapakahabalayout,daratingbosescigarettemoreinfluentialnakapagngangalitnakakatawapagkakatuwaansiyammahaltsismosanaglutotumatawadclassespakakasalannatuwalalokalarosandwichdahannaghubadpwedengnagbibigayanempresasbagyongkatagalancoughingipinambilimawalabereticommercialbarcelonaspeechinspirationcentertulanghoycareermaisipmatayogadecuadotandangdalawakasingtigasvehiclesnicobumabagtarcilanakabilicornershayaanghouseholdsguardakatabingnahulifurmayroongabingkuligligmataraytalentedcarriesnasusunogtuwidcharmingfiguresideashumanossueloflyappworkdayboymaestraeksamlightsnakinigbolasellingnathanmasaganangtaga-lupangpalitankaurianibersaryopalagingpahahanapwalismasayadali-dalingnapakagagandaunderholderkalabanbanyobigyangutomdeveloplivespatunayanpangalanexpertisepitumpongcubiclenamrabeclasesbusloiskolaryngitissinagotsigurobiyaknakikini-kinitaganidlargermagpasalamatnakalockpinapataposstrategiesairporttinaasancars