Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

100 sentences found for "been"

1. Additionally, television has also been used as a tool for educational programming, such as Sesame Street, which has helped to teach young children reading, writing, and math

2. All these years, I have been blessed with experiences that have shaped me into the person I am today.

3. All these years, I have been blessed with the love and support of my family and friends.

4. All these years, I have been building a life that I am proud of.

5. All these years, I have been chasing my passions and following my heart.

6. All these years, I have been cherishing the relationships and connections that matter most to me.

7. All these years, I have been creating memories that will last a lifetime.

8. All these years, I have been discovering who I am and who I want to be.

9. All these years, I have been grateful for the journey and excited for what the future holds.

10. All these years, I have been grateful for the opportunities that have come my way.

11. All these years, I have been inspired by the resilience and strength of those around me.

12. All these years, I have been learning and growing as a person.

13. All these years, I have been learning to appreciate the present moment and not take life for granted.

14. All these years, I have been making mistakes and learning from them.

15. All these years, I have been overcoming challenges and obstacles to reach my goals.

16. All these years, I have been reminded of the importance of love, kindness, and compassion.

17. All these years, I have been striving to be the best version of myself.

18. All these years, I have been striving to live a life of purpose and meaning.

19. All these years, I have been surrounded by people who believe in me.

20. All these years, I have been working hard to achieve my dreams.

21. All these years, I have been working to make a positive impact on the world.

22. Amazon has been involved in the development of autonomous vehicles and drone delivery technology.

23. Amazon has been praised for its environmental initiatives, such as its commitment to renewable energy.

24. Amazon's influence on the retail industry has been significant, and its impact is likely to continue to be felt in the years to come.

25. But recently it has been detected that the habit of smoking causes different kinds of serious physical ailments, beginning with coughing, sore throat, laryngitis, and asthma, and ending with such a fatal disease as cancer

26. Chris Paul is a skilled playmaker and has consistently been one of the best point guards in the league.

27. Coffee has been shown to have several potential health benefits, including reducing the risk of type 2 diabetes and Parkinson's disease.

28. Einstein's brain was preserved after his death and has been studied by scientists to try to understand the neural basis of his exceptional intelligence.

29. Foreclosed properties are homes that have been repossessed by the bank or lender due to the homeowner's inability to pay their mortgage.

30. Han er den eneste, jeg nogensinde har været forelsket i. (He's the only one I've ever been in love with.)

31. Have you been to the new restaurant in town?

32. He has been building a treehouse for his kids.

33. He has been gardening for hours.

34. He has been hiking in the mountains for two days.

35. He has been meditating for hours.

36. He has been named NBA Finals MVP four times and has won four regular-season MVP awards.

37. He has been playing video games for hours.

38. He has been practicing basketball for hours.

39. He has been practicing the guitar for three hours.

40. He has been practicing yoga for years.

41. He has been repairing the car for hours.

42. He has been to Paris three times.

43. He has been working on the computer for hours.

44. He has been writing a novel for six months.

45. Her perfume line, including fragrances like "Cloud" and "Thank U, Next," has been highly successful.

46. Hi, we haven't been properly introduced. May I know your name?

47. His influence continues to be felt in the world of music, and his legacy lives on through the countless artists and fans who have been inspired by his work

48. However, concerns have been raised about the potential impact of AI algorithms on jobs and society as a whole.

49. I discovered a new online game on a gaming website that I've been playing for hours.

50. I have been jogging every day for a week.

51. I have been learning to play the piano for six months.

52. I have been studying English for two hours.

53. I have been swimming for an hour.

54. I have been taking care of my sick friend for a week.

55. I have been watching TV all evening.

56. I have been working on this project for a week.

57. I have never been to Asia.

58. I've been driving on this road for an hour, and so far so good.

59. I've been following the diet plan for a week, and so far so good.

60. I've been taking care of my health, and so far so good.

61. I've been using this new software, and so far so good.

62. Illegal drug traffic across the border has been a major concern for law enforcement.

63. In the last three hundred years, many human efforts have been spent in search of sources of energy-coal, petroleum, and power generated from water which will maintain the present rhythm of civilization unchecked

64. It has been found that by abstaining from smoking a person may be cured of many diseases

65. Jeg har været forelsket i ham i lang tid. (I've been in love with him for a long time.)

66. Microscopes have been used to discover and identify new species of microorganisms and other small organisms.

67. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

68. Musk has been at the forefront of developing electric cars and sustainable energy solutions.

69. Musk has been described as a visionary and a disruptor in the business world.

70. Musk has been involved in various controversies over his comments on social and political issues.

71. Musk has been married three times and has six children.

72. Musk has been named one of the most influential people in the world by TIME magazine.

73. Musk has been vocal about his concerns over the potential dangers of artificial intelligence.

74. Musk's companies have been recognized for their innovation and sustainability efforts.

75. Nationalism has been a driving force behind movements for independence and self-determination.

76. Nationalism has been a powerful force in shaping the modern world, particularly in the aftermath of colonialism.

77. Nationalism has been an important factor in the formation of modern states and the boundaries between them.

78. Nationalism has been used to justify imperialism and expansionism.

79. Nationalism has been used to mobilize people in times of war and crisis.

80. One of the most significant areas of technological advancement in recent years has been in the field of communications

81. One of the most significant impacts of television has been on the way that people consume media

82. Pardon me, but I don't think we've been introduced. May I know your name?

83. She had been studying hard and therefore received an A on her exam.

84. She has been baking cookies all day.

85. She has been cooking dinner for two hours.

86. She has been exercising every day for a month.

87. She has been knitting a sweater for her son.

88. She has been learning French for six months.

89. She has been making jewelry for years.

90. She has been preparing for the exam for weeks.

91. She has been running a marathon every year for a decade.

92. She has been teaching English for five years.

93. She has been tutoring students for years.

94. She has been working in the garden all day.

95. She has been working on her art project for weeks.

96. Some kings have been deposed or overthrown, such as King Louis XVI of France during the French Revolution.

97. Some kings have been known for their military conquests, such as Alexander the Great and Napoleon Bonaparte.

98. The app has also been praised for giving a platform to underrepresented voices and marginalized communities.

99. The belief in God is widespread throughout human history and has been expressed in various religious traditions.

100. The car might look old, but you can't judge a book by its cover - it's been well-maintained and runs smoothly.

Random Sentences

1. Sa bawat pagkakataon, dapat nating ipaglaban at ipagtagumpay ang ating kalayaan.

2. They are often served with a side of toast, hash browns, or fresh greens.

3. Forgiveness is a personal journey that varies for each individual; there is no set timeline or right way to forgive.

4. La pièce montée était absolument délicieuse.

5. Si Jose Rizal ay pinagpalaluan ng mga Pilipino bilang bayani ng bansa.

6. Hindi ko alam kung paano ko sasabihin, pero crush kita.

7. Don't dismiss someone just because of their appearance - you can't judge a book by its cover.

8. Ano ang ginawa ni Tess noong Abril?

9. Alice falls down a rabbit hole and enters a whimsical world in Alice in Wonderland.

10. En invierno, las temperaturas suelen ser bajas y el clima es más fresco.

11. Cryptocurrency is a digital or virtual currency that uses cryptography to secure and verify transactions.

12. Hindi ko alam kung may pag-asa ako sa iyo, pero sana pwede ba kitang mahalin?

13. Bakit sila nandito tanong ko sa sarili ko.

14.

15. Helte findes i alle samfund.

16. Kailangan ko ng pliers, puwede ko bang hiramin ang iyong tools?

17. Paglingon ko, nakita kong papalapit sakin si Lory.

18. Sweetness can be used in savory dishes, such as sweet and sour chicken and honey-glazed ham.

19. Ang paggamit ng mga aromang nakakarelaks tulad ng lavender ay nagbibigay sa akin ng isang matiwasay na tulog.

20. Eating fresh, unprocessed foods can help reduce the risk of heart disease and diabetes.

21. Madilim ang paligid kaya kinailangan niyang salatin ang daan pabalik.

22. Seryoso? Ngayon ka lang nakakaen sa fastfood? tanong ko.

23. Ikinalulungkot ko ang balitang yan.

24. He is painting a picture.

25. Buksan ang puso at isipan.

26. Les élèves doivent travailler dur pour obtenir de bonnes notes.

27. They have been studying for their exams for a week.

28. May mga taong nagkakaroon ng mga panaginip tuwing natutulog sila.

29. Waring may nais siyang sabihin, ngunit pinili niyang manahimik.

30. Lazada has a reputation for offering competitive prices and discounts.

31. Sinigurado ko na mayroon akong sapat na oras bago magdilim sa dakong huli ng araw.

32. The platform offers various filters and editing tools to enhance the appearance of photos before posting.

33. El que mucho abarca, poco aprieta. - Jack of all trades, master of none.

34. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

35. Sa kanyang paglalakad sa kahabaan ng dagat, napadungaw siya sa malalaking alon at namangha sa kanilang ganda.

36. Nakita ko ang mga kapatid ko noong pasko.

37. Naalala niya ang itinuturo ng misyunero na si Hesus daw ay muling nabuhay pagkalipas ng tatlong araw

38. Salatin mo ang kahon kung may natira pang laman.

39. James A. Garfield, the twentieth president of the United States, served for only 200 days in 1881 before his assassination.

40. I'm not superstitious, but I always say "break a leg" to my friends before a big test or presentation.

41. Wer nicht wagt, der nicht gewinnt.

42. Arbejdsgivere kan bruge fleksible arbejdsmetoder for at hjælpe medarbejdere med at balancere deres arbejds- og privatliv.

43. Ang bata ay takot na nakatingin sa kanya.

44. Napatungo ako dahil nangingilid na naman ang mata ko.

45. Tila bakal na kumakapit ang mga kamay.

46. Emphasis can help clarify and reinforce the meaning of a message.

47. Puwede paki-ulit ang sinabi mo?

48. Leukemia research continues to improve our understanding of the disease and develop more effective treatments.

49. It has revolutionized the way we communicate, allowing us to talk to people anywhere in the world at any time

50. Videnskab er systematisk undersøgelse af natur og universet ved hjælp af metoder som observation, eksperimentering og analyse

Recent Searches

beenpaslitideyamaarawpiyanokambingmagbibiyahetinulak-tulaknalalabingnanahimikcarsnagbentausuariotahimikpagkababama-buhaykalakihanmagalitnakisakaybinge-watchingresortregulering,sinunud-ssunodgumandacountryfulfillmentarkilabutinanoodseniorstoiniibignagmumukhacapacidadlingidbegangivetherapybabaenitongmangingisdaiikligeneratemejoagadburmadevelopmentbackbehindfindchecksnaiilaganhavemakalawanabalitaannakapagngangalithumiwalaysertreatsnagsisigawnasasalinanpeksmanpaki-drawingmanahimikbarrocoseryosongmahuhuligawaingkapaligirannapilibarcelonaorganizeniyogpapayaninaculpritpagsusulitkesotaxikablannagkabungavehiclesonlinelumalangoyroselleso-calledtaniminantokheipasanbiggest1982seencigarettewhilemakapilinginternallandlinepalibhasamahalagamagpalibrenagtitindaomfattendenakakagalingnakaangatkahirapanpresencemarangalairportseguridadkahongbalediktoryankaharianmamahalintennisnasawisementongnagsilapitnarinigmaghapongsaktannatutuwarepresentedasahanmaisipasulmatayogpagputihangaringpaskongofteiloghansaglitwritingsaranggoladumagundongnapakagagandatinahakadmiredhinilapanaloaddictionannikaaffiliatekinalimutantilatawaalaysimbahandiyoscnicopagecinepolobetasystemkumarimotfacilitatingventaechaveattackbitbitatepaki-translatenagtutulunganamoycapacidadeswhyskabteskuwelahangrupokaibiganexhaustionnanlilisiknag-aagawannapapalibutanpagsumamoinakalangpalabuy-laboynyebrasosaringmateryaleskaninumankamakailanclienteshaponnagpalutonagdadasalsamantalangtungofranciscopagbebentangipingdisciplinnaguusapplagasimbesmataman