Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

100 sentences found for "been"

1. Additionally, television has also been used as a tool for educational programming, such as Sesame Street, which has helped to teach young children reading, writing, and math

2. All these years, I have been blessed with experiences that have shaped me into the person I am today.

3. All these years, I have been blessed with the love and support of my family and friends.

4. All these years, I have been building a life that I am proud of.

5. All these years, I have been chasing my passions and following my heart.

6. All these years, I have been cherishing the relationships and connections that matter most to me.

7. All these years, I have been creating memories that will last a lifetime.

8. All these years, I have been discovering who I am and who I want to be.

9. All these years, I have been grateful for the journey and excited for what the future holds.

10. All these years, I have been grateful for the opportunities that have come my way.

11. All these years, I have been inspired by the resilience and strength of those around me.

12. All these years, I have been learning and growing as a person.

13. All these years, I have been learning to appreciate the present moment and not take life for granted.

14. All these years, I have been making mistakes and learning from them.

15. All these years, I have been overcoming challenges and obstacles to reach my goals.

16. All these years, I have been reminded of the importance of love, kindness, and compassion.

17. All these years, I have been striving to be the best version of myself.

18. All these years, I have been striving to live a life of purpose and meaning.

19. All these years, I have been surrounded by people who believe in me.

20. All these years, I have been working hard to achieve my dreams.

21. All these years, I have been working to make a positive impact on the world.

22. Amazon has been involved in the development of autonomous vehicles and drone delivery technology.

23. Amazon has been praised for its environmental initiatives, such as its commitment to renewable energy.

24. Amazon's influence on the retail industry has been significant, and its impact is likely to continue to be felt in the years to come.

25. But recently it has been detected that the habit of smoking causes different kinds of serious physical ailments, beginning with coughing, sore throat, laryngitis, and asthma, and ending with such a fatal disease as cancer

26. Chris Paul is a skilled playmaker and has consistently been one of the best point guards in the league.

27. Coffee has been shown to have several potential health benefits, including reducing the risk of type 2 diabetes and Parkinson's disease.

28. Einstein's brain was preserved after his death and has been studied by scientists to try to understand the neural basis of his exceptional intelligence.

29. Foreclosed properties are homes that have been repossessed by the bank or lender due to the homeowner's inability to pay their mortgage.

30. Han er den eneste, jeg nogensinde har været forelsket i. (He's the only one I've ever been in love with.)

31. Have you been to the new restaurant in town?

32. He has been building a treehouse for his kids.

33. He has been gardening for hours.

34. He has been hiking in the mountains for two days.

35. He has been meditating for hours.

36. He has been named NBA Finals MVP four times and has won four regular-season MVP awards.

37. He has been playing video games for hours.

38. He has been practicing basketball for hours.

39. He has been practicing the guitar for three hours.

40. He has been practicing yoga for years.

41. He has been repairing the car for hours.

42. He has been to Paris three times.

43. He has been working on the computer for hours.

44. He has been writing a novel for six months.

45. Her perfume line, including fragrances like "Cloud" and "Thank U, Next," has been highly successful.

46. Hi, we haven't been properly introduced. May I know your name?

47. His influence continues to be felt in the world of music, and his legacy lives on through the countless artists and fans who have been inspired by his work

48. However, concerns have been raised about the potential impact of AI algorithms on jobs and society as a whole.

49. I discovered a new online game on a gaming website that I've been playing for hours.

50. I have been jogging every day for a week.

51. I have been learning to play the piano for six months.

52. I have been studying English for two hours.

53. I have been swimming for an hour.

54. I have been taking care of my sick friend for a week.

55. I have been watching TV all evening.

56. I have been working on this project for a week.

57. I have never been to Asia.

58. I've been driving on this road for an hour, and so far so good.

59. I've been following the diet plan for a week, and so far so good.

60. I've been taking care of my health, and so far so good.

61. I've been using this new software, and so far so good.

62. Illegal drug traffic across the border has been a major concern for law enforcement.

63. In the last three hundred years, many human efforts have been spent in search of sources of energy-coal, petroleum, and power generated from water which will maintain the present rhythm of civilization unchecked

64. It has been found that by abstaining from smoking a person may be cured of many diseases

65. Jeg har været forelsket i ham i lang tid. (I've been in love with him for a long time.)

66. Microscopes have been used to discover and identify new species of microorganisms and other small organisms.

67. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

68. Musk has been at the forefront of developing electric cars and sustainable energy solutions.

69. Musk has been described as a visionary and a disruptor in the business world.

70. Musk has been involved in various controversies over his comments on social and political issues.

71. Musk has been married three times and has six children.

72. Musk has been named one of the most influential people in the world by TIME magazine.

73. Musk has been vocal about his concerns over the potential dangers of artificial intelligence.

74. Musk's companies have been recognized for their innovation and sustainability efforts.

75. Nationalism has been a driving force behind movements for independence and self-determination.

76. Nationalism has been a powerful force in shaping the modern world, particularly in the aftermath of colonialism.

77. Nationalism has been an important factor in the formation of modern states and the boundaries between them.

78. Nationalism has been used to justify imperialism and expansionism.

79. Nationalism has been used to mobilize people in times of war and crisis.

80. One of the most significant areas of technological advancement in recent years has been in the field of communications

81. One of the most significant impacts of television has been on the way that people consume media

82. Pardon me, but I don't think we've been introduced. May I know your name?

83. She had been studying hard and therefore received an A on her exam.

84. She has been baking cookies all day.

85. She has been cooking dinner for two hours.

86. She has been exercising every day for a month.

87. She has been knitting a sweater for her son.

88. She has been learning French for six months.

89. She has been making jewelry for years.

90. She has been preparing for the exam for weeks.

91. She has been running a marathon every year for a decade.

92. She has been teaching English for five years.

93. She has been tutoring students for years.

94. She has been working in the garden all day.

95. She has been working on her art project for weeks.

96. Some kings have been deposed or overthrown, such as King Louis XVI of France during the French Revolution.

97. Some kings have been known for their military conquests, such as Alexander the Great and Napoleon Bonaparte.

98. The app has also been praised for giving a platform to underrepresented voices and marginalized communities.

99. The belief in God is widespread throughout human history and has been expressed in various religious traditions.

100. The car might look old, but you can't judge a book by its cover - it's been well-maintained and runs smoothly.

Random Sentences

1. For eksempel kan vi nu tale med vores enheder og få dem til at udføre opgaver for os

2. Nakasuot siya ng damit na pambahay.

3. Ang paglalakad sa kalikasan at pakikisalamuha sa kalikasan ay nakagagamot sa aking isip at katawan.

4. Kucing di Indonesia juga sering dibawa ke salon kucing untuk melakukan perawatan bulu dan kesehatan mereka.

5. Noong una ho akong magbakasyon dito.

6. Las heridas en las extremidades pueden requerir de vendajes compresivos para detener el sangrado.

7. pagkaraan ng kargang iyon ay uuwi na siya.

8. Kapag niluluto ni Tatay ang adobo, ang amoy ay sobrang mabango at nakakagutom.

9. Ang kanyang mga galaw ay tila naglalayo ng loob ng iba, palayo sa kanya.

10. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

11. The charitable organization provides free medical services to remote communities.

12. Members of the US

13. Lazada offers a fulfillment service called Fulfillment by Lazada (FBL), which allows sellers to store their products in Lazada's warehouses and have Lazada handle shipping and customer service.

14.

15. Det har også ændret måden, vi underholder os og håndterer vores daglige opgaver

16. Kailangan nating magsumikap upang makamit ang ating mga pangarap.

17. Mahalaga ang pagkakaroon ng kalayaan sa edukasyon upang mapalawak ang ating kaalaman at pag-iisip.

18. The Lakers' success can be attributed to their strong team culture, skilled players, and effective coaching.

19. Mula sa pagiging simpleng atleta, si Hidilyn Diaz ay naging simbolo ng determinasyon at tagumpay.

20. Las personas pobres a menudo enfrentan barreras para acceder a la justicia y la igualdad de oportunidades.

21. Ang mga bata ay lumabas ng paaralan nang limahan.

22. The experience of bungee jumping was both terrifying and euphoric.

23. Hindi sapat na bukas palad ka lang sa mga panahon na kailangan mo ng tulong, dapat bukas palad ka rin sa mga taong nangangailangan ng tulong mo.

24. Mayaman ang amo ni Lando.

25. Ang sugal ay isang mapanlinlang na industriya na nakatuon sa pagkuha ng pera mula sa mga manlalaro.

26. Dedication is the driving force behind artists who spend countless hours honing their craft.

27. Sa brainly ako madalas nakakakuha ng ideya.

28. Ang Tagaytay ay itinuturing na "Little baguio dahil sa lamig ng klima dito".

29. Maging ang mga mahihirap na disenyo ay kaya ng gawin ng bata sa murang edad.

30. In conclusion, Bruce Lee was a martial artist, actor, and philosopher who is widely considered to be one of the most influential figures in the history of martial arts

31. Le jeu est une forme de divertissement dans laquelle on mise de l'argent sur un événement aléatoire.

32. The mission was labeled as risky, but the team decided to proceed.

33. Before the advent of television, people had to rely on radio, newspapers, and magazines for their news and entertainment

34. Ang kalayaan ay hindi lamang tungkol sa pagiging malaya sa pagpapahayag ng ating mga saloobin, ito rin ay tungkol sa pagpili ng ating mga sariling desisyon at pagpapasya sa ating buhay.

35. Pinaghihiwa ko ang mga kamatis.

36. Orang tua bayi sering kali merayakan hari ulang tahun anak mereka setiap tahunnya dengan acara yang meriah.

37. Matitigas at maliliit na buto.

38. Lumampas ka sa dalawang stoplight.

39. Gusto ko sanang makabili ng bahay.

40. El nacimiento puede ser un momento de reflexión y celebración, y puede marcar el comienzo de una nueva etapa en la vida de la familia.

41. Frustration can lead to impulsive or rash decision-making, which can make the situation worse.

42. Maririnig mo ang kanyang halinghing kapag sumasakay ng bisikleta sa mababang gear.

43. Mabilis nyang kinuha ang laptop upang tapusin ang kanyang nobela.

44. Tanggapin mo na lang ang katotohanan.

45. Quiero hacer una contribución significativa a la ciencia a través de mi investigación. (I want to make a significant contribution to science through my research.)

46. Short-term investors may be more focused on quick profits, while long-term investors may be more focused on building wealth over time.

47. Inaamin ko na ang pagkakamali ko.

48. Omelettes are quick and easy to prepare, making them a convenient meal option.

49. Nakapasa si Andrew sa pagsusulit.

50. Mabilis na pinabulaan ni Paniki na siya as isang mabangis na hayop; siya raw ay isang ibon.

Recent Searches

targetpapuntabeenmapakalipasswordbornuniquebabaprocessamazoneffectreadinterviewingnotebookcountlessflyrawbitawanpasangknowsbadendbirthdayuniversalbinilingikinalulungkotngumitikomedornanahimiknananaghilinaghihiraptahimiktog,usuarionaninirahanbilitangangraphicreachsiyamargueseniorencompassesburmaalas-dosguiltymagta-taxiipagtimplanagtaasserviceswhynakapaligidbagkusnaglalakadna-fundincluirlabornakasumagotbreaksatisfactionexpectationsfraomelettepootbarangayphilippinemakapangyarihangkalalakihanalas-diyeskasuutanpagtutolmarurumipagpapatubonagkakakainanumangaustralianagtagpobotongnapakamethodsexplainquicklyalignsoffentlighimselfpeaceiiwanpundidocultivationcualquierengkantadangressourcernenagpapaigibpangyayariitokarunungandahan-dahancarsnagtutulakpacienciaibat-ibangkumidlatnawawalainspirationsurveysalanganpinansinpersoninspirebanlagentertainmentbunutanahasbrasoantoksellingpalayaniyacomputere,busyblusahydelunderholderbuslocomienzangranadaballbelievednathansorrytenincludefacultycablebeginningnilutotanimibalikingatanbarogrinsbansapag-aaralangnagdudumalingsuccessnapaplastikanmurang-muranagulatpinakamatabangmarketplaceslihimginawarankaninonovellesmabihisanmakasakayi-rechargenakadapanabighanipanghabambuhayendviderenatakotmisyunerongpinisilincitamenternakabiladmalilimutanengkantadakanayangipinambilihoynatagalanmayabongnapapikitlabahinsentencebestkulotcarmenadvancebuslacksumalidyanbarrierssteerhimigeyeparatinginalismessagegenerateddumaramiprovidedmediummarunongfatalitemschoice