Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

100 sentences found for "been"

1. Additionally, television has also been used as a tool for educational programming, such as Sesame Street, which has helped to teach young children reading, writing, and math

2. All these years, I have been blessed with experiences that have shaped me into the person I am today.

3. All these years, I have been blessed with the love and support of my family and friends.

4. All these years, I have been building a life that I am proud of.

5. All these years, I have been chasing my passions and following my heart.

6. All these years, I have been cherishing the relationships and connections that matter most to me.

7. All these years, I have been creating memories that will last a lifetime.

8. All these years, I have been discovering who I am and who I want to be.

9. All these years, I have been grateful for the journey and excited for what the future holds.

10. All these years, I have been grateful for the opportunities that have come my way.

11. All these years, I have been inspired by the resilience and strength of those around me.

12. All these years, I have been learning and growing as a person.

13. All these years, I have been learning to appreciate the present moment and not take life for granted.

14. All these years, I have been making mistakes and learning from them.

15. All these years, I have been overcoming challenges and obstacles to reach my goals.

16. All these years, I have been reminded of the importance of love, kindness, and compassion.

17. All these years, I have been striving to be the best version of myself.

18. All these years, I have been striving to live a life of purpose and meaning.

19. All these years, I have been surrounded by people who believe in me.

20. All these years, I have been working hard to achieve my dreams.

21. All these years, I have been working to make a positive impact on the world.

22. Amazon has been involved in the development of autonomous vehicles and drone delivery technology.

23. Amazon has been praised for its environmental initiatives, such as its commitment to renewable energy.

24. Amazon's influence on the retail industry has been significant, and its impact is likely to continue to be felt in the years to come.

25. But recently it has been detected that the habit of smoking causes different kinds of serious physical ailments, beginning with coughing, sore throat, laryngitis, and asthma, and ending with such a fatal disease as cancer

26. Chris Paul is a skilled playmaker and has consistently been one of the best point guards in the league.

27. Coffee has been shown to have several potential health benefits, including reducing the risk of type 2 diabetes and Parkinson's disease.

28. Einstein's brain was preserved after his death and has been studied by scientists to try to understand the neural basis of his exceptional intelligence.

29. Foreclosed properties are homes that have been repossessed by the bank or lender due to the homeowner's inability to pay their mortgage.

30. Han er den eneste, jeg nogensinde har været forelsket i. (He's the only one I've ever been in love with.)

31. Have you been to the new restaurant in town?

32. He has been building a treehouse for his kids.

33. He has been gardening for hours.

34. He has been hiking in the mountains for two days.

35. He has been meditating for hours.

36. He has been named NBA Finals MVP four times and has won four regular-season MVP awards.

37. He has been playing video games for hours.

38. He has been practicing basketball for hours.

39. He has been practicing the guitar for three hours.

40. He has been practicing yoga for years.

41. He has been repairing the car for hours.

42. He has been to Paris three times.

43. He has been working on the computer for hours.

44. He has been writing a novel for six months.

45. Her perfume line, including fragrances like "Cloud" and "Thank U, Next," has been highly successful.

46. Hi, we haven't been properly introduced. May I know your name?

47. His influence continues to be felt in the world of music, and his legacy lives on through the countless artists and fans who have been inspired by his work

48. However, concerns have been raised about the potential impact of AI algorithms on jobs and society as a whole.

49. I discovered a new online game on a gaming website that I've been playing for hours.

50. I have been jogging every day for a week.

51. I have been learning to play the piano for six months.

52. I have been studying English for two hours.

53. I have been swimming for an hour.

54. I have been taking care of my sick friend for a week.

55. I have been watching TV all evening.

56. I have been working on this project for a week.

57. I have never been to Asia.

58. I've been driving on this road for an hour, and so far so good.

59. I've been following the diet plan for a week, and so far so good.

60. I've been taking care of my health, and so far so good.

61. I've been using this new software, and so far so good.

62. Illegal drug traffic across the border has been a major concern for law enforcement.

63. In the last three hundred years, many human efforts have been spent in search of sources of energy-coal, petroleum, and power generated from water which will maintain the present rhythm of civilization unchecked

64. It has been found that by abstaining from smoking a person may be cured of many diseases

65. Jeg har været forelsket i ham i lang tid. (I've been in love with him for a long time.)

66. Microscopes have been used to discover and identify new species of microorganisms and other small organisms.

67. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

68. Musk has been at the forefront of developing electric cars and sustainable energy solutions.

69. Musk has been described as a visionary and a disruptor in the business world.

70. Musk has been involved in various controversies over his comments on social and political issues.

71. Musk has been married three times and has six children.

72. Musk has been named one of the most influential people in the world by TIME magazine.

73. Musk has been vocal about his concerns over the potential dangers of artificial intelligence.

74. Musk's companies have been recognized for their innovation and sustainability efforts.

75. Nationalism has been a driving force behind movements for independence and self-determination.

76. Nationalism has been a powerful force in shaping the modern world, particularly in the aftermath of colonialism.

77. Nationalism has been an important factor in the formation of modern states and the boundaries between them.

78. Nationalism has been used to justify imperialism and expansionism.

79. Nationalism has been used to mobilize people in times of war and crisis.

80. One of the most significant areas of technological advancement in recent years has been in the field of communications

81. One of the most significant impacts of television has been on the way that people consume media

82. Pardon me, but I don't think we've been introduced. May I know your name?

83. She had been studying hard and therefore received an A on her exam.

84. She has been baking cookies all day.

85. She has been cooking dinner for two hours.

86. She has been exercising every day for a month.

87. She has been knitting a sweater for her son.

88. She has been learning French for six months.

89. She has been making jewelry for years.

90. She has been preparing for the exam for weeks.

91. She has been running a marathon every year for a decade.

92. She has been teaching English for five years.

93. She has been tutoring students for years.

94. She has been working in the garden all day.

95. She has been working on her art project for weeks.

96. Some kings have been deposed or overthrown, such as King Louis XVI of France during the French Revolution.

97. Some kings have been known for their military conquests, such as Alexander the Great and Napoleon Bonaparte.

98. The app has also been praised for giving a platform to underrepresented voices and marginalized communities.

99. The belief in God is widespread throughout human history and has been expressed in various religious traditions.

100. The car might look old, but you can't judge a book by its cover - it's been well-maintained and runs smoothly.

Random Sentences

1. May dalawang libro ang estudyante.

2. Isa sa tatlong magagandang magkakapatid si Psyche.

3. Pakibigay sa akin ang iyong opinyon tungkol sa balitang nabasa mo.

4. However, investing also carries risk, as the value of investments can fluctuate and can result in losses.

5. Ang pagkakaisa ng buong nayon sa panahon ng krisis ay lubos na ikinagagalak ng kanilang lider.

6. Omelettes are a popular choice for those following a low-carb or high-protein diet.

7. Napahinto siya sa pag lalakad tapos lumingon sa akin.

8. Sa ilalim ng malawak na upuan, nakita ko ang isang mayabong na lumot.

9. He has numerous endorsement deals and business ventures, including his own media production company, SpringHill Entertainment.

10. The concept of money has been around for thousands of years and has evolved over time.

11. Masarap ang litson kaya lang nakakataba.

12. Users can save posts they like or want to revisit later by using the bookmark feature on Instagram.

13. Ang aking kabiyak ay palaging nasa tabi ko sa hirap at ginhawa.

14. Jack and the Beanstalk tells the story of a young boy who trades his cow for magic beans.

15. Bukas ay magpapagupit na ako ng buhok.

16. Hindi ito maganda na maging sobrang takot sa lahat ng bagay dahil lamang sa agam-agam.

17. Les enseignants peuvent organiser des projets de groupe pour encourager la collaboration et la créativité des élèves.

18. El paisaje que rodea la playa es sublime, con sus aguas cristalinas y suave arena.

19. Sa aming pagdiriwang ng buwan ng wika, nagkaroon kami ng pagtatanghal na nagpapakita ng kahalagahan ng bayanihan.

20. Red horse? Ikaw? nagtatakang tanong ni Genna.

21. Ang paggamit ng mga apps at gadgets bago matulog ay maaaring makaapekto sa kalidad ng tulog ng isang tao.

22. It is a versatile dish that can be customized with various fillings and toppings.

23. Hawak ang tirador ay sinaliksik ni Kiko ang buong paligid.

24. Naku di po ganun si Maico. automatic na sagot ko.

25. Les hôpitaux sont équipés pour fournir des soins d'urgence aux patients.

26. El deportista produjo un gran esfuerzo para ganar la competencia.

27. Les soins palliatifs et la fin de vie sont des aspects importants des soins de santé.

28. Tengo náuseas. (I feel nauseous.)

29. Gusto kong manood ng mga pambatang palabas.

30. Palibhasa ay madalas na mas matalino kaysa sa ibang mga tao sa kanyang paligid.

31. Twitter has implemented features like live video streaming, Twitter Spaces (audio chat rooms), and fleets (disappearing tweets).

32. Anong pangalan niya? Maganda siya ha.

33. Suot mo yan para sa party mamaya.

34. John Quincy Adams, the sixth president of the United States, served from 1825 to 1829 and was the son of the second president, John Adams.

35. Ang kalayaan ay hindi dapat magdulot ng pang-aabuso sa kapwa.

36. En invierno, se encienden chimeneas y estufas para mantener el calor en las casas.

37. Sa halip na umalis ay lalong lumapit ang bata.

38. Este año planeamos viajar a España durante las vacaciones de verano.

39. Chester A. Arthur, the twenty-first president of the United States, served from 1881 to 1885 and signed the Pendleton Civil Service Reform Act.

40. Format your book: Once your book is finalized, it's time to format it for publication

41. Kehidupan penuh dengan tantangan yang harus dihadapi setiap orang.

42. Pakibigay ng oras para makapagpahinga ang iyong sarili.

43. Si Maria ay nagpasya nang lumayo mula sa kanyang asawa dahil sa patuloy na pisikal na abuso.

44. Nahahalinhan ng takot at lungkot nang kumulog at kumidlat.

45. Naglaro sa palaruan ang mga bata nang limahan.

46. Nogle lande og jurisdiktioner har lovgivning, der regulerer gambling for at beskytte spillerne og modvirke kriminalitet.

47. Ano ang ginagawa mo nang nagkasunog?

48. Napakalaki talaga ng isla sa boracay.

49. Napagod siya dahil magdamagan ang trabaho.

50. Dahil sa maling pagdisiplina, naglipana ang mga pangit na gawi sa lipunan.

Recent Searches

beenareaboyfriendwaysneedseducationalinaliswantpagluluksawaitunti-untinggumagalaw-galawprogramatsakakangkongwaaasedentaryngumingisiuwakgatherhamakmagpa-pictureuuwiplasmakuboutakdalawbingbingunangmethodstypesettingevolvedcuandonagcurvegitaracompletecontrolledpilingnagliwanagconditionnegosyanteturonagngangalangwaldopulang-pulanapatawagbasahanmusiciannakaka-innagmakaawakasaganaannagtagisanpagkakayakapturnnakakapagpatibaynamumulaklakpunongkahoykinakitaanmahiyatuloewantssscomunicarsetonymagsasakawouldtongnagsinemasasabidistanciatog,re-reviewpuntahanna-fundpahiramnaglokolumamangpamasahetiyokagayatitopabulongcubicleskypetimenapatingintiisthemnaghuhumindigmakapagmanehohandaantexttaga-hiroshimanagdiretsona-suwayhouseholdspioneernananalomagpapagupitfrasumugodnapakasipagpagmamanehona-curioustekafulfillmentpinipilitmalalakipinabulaantulisanpapuntangdadalawnaiiritangtaracanadatamamerrytalegreatlycompletamentetalanakatingingkerbtaashinanakithaltsusialikabukinsuchnagtataassoonsnobnearsizecontinuedipinangangaksinkpanataginiangataustraliamaaksidentenagplaygatasbinitiwandireksyontiniklingnangagsipagkantahansineanothersighproductshikingsigetanganricostreetnagisingnatinagasiabantulotbibilhinpagkagustoparkepaninginlaybrarisonidoshetnuhpasigawconsumemalikotfitthankinihandaselaseeksayosay,mahalagasalesafetoothbrushamofionakapesaanfaultmorenatapatiilanhopebutchkatandaanryankanserroomritanapadaanring