Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

4 sentences found for "sonido"

1. El primer llanto del bebé es un hermoso sonido que indica vida y salud.

2. El teléfono es un dispositivo electrónico que permite la comunicación a distancia mediante el uso de señales de sonido

3. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

4. En resumen, el teléfono es un dispositivo electrónico que permite la comunicación a distancia mediante el uso de señales de sonido

Random Sentences

1. Let's stop ignoring the elephant in the room and have an honest conversation about our problems.

2. Ang pagkakaisa ng buong nayon sa panahon ng krisis ay lubos na ikinagagalak ng kanilang lider.

3. Sa takip-silim, maaari kang mapakali at magpakalma matapos ang isang mahabang araw.

4. Rutherford B. Hayes, the nineteenth president of the United States, served from 1877 to 1881 and oversaw the end of Reconstruction.

5. O-order na ako. sabi ko sa kanya.

6. Nangyari ang aksidente sa daan kahapon kaya maraming sasakyan ang naabala.

7. Det er vigtigt at huske heltenes bedrifter og lære af dem.

8. She does not smoke cigarettes.

9. No puedo controlar las acciones de los demás, solo puedo aceptarlas con "que sera, sera."

10. Cheating can be caused by various factors, including boredom, lack of intimacy, or a desire for novelty or excitement.

11. Hala, gusto mo tissue? Sorry ah, hindi ko alam.

12. Napatingin siya sa akin at ngumiti.

13. Einstein developed the theory of special relativity while working as a patent clerk in Bern, Switzerland.

14. Madalas syang sumali sa poster making contest.

15. Nang biglaang magdidilim ang paligid, nahirapan akong makita ang daan pauwi.

16. It is a form of electronic communication that transmits moving images and sound to a television set, allowing people to watch live or recorded programs

17. We should have painted the house last year, but better late than never.

18. Buti na lang medyo nagiislow down na yung heart rate ko.

19. Transkønnede personer er mennesker, der føler sig som det modsatte køn af det, de blev tildelt ved fødslen.

20. Hindi ko na kayang itago ito - may gusto ako sa iyo.

21. Ang mga punong-kahoy ay kabilang sa mga pangunahing likas na yaman ng ating bansa.

22. Ilang oras na ang nakalipas ngunit hindi pa nauwi ang batang si Ana, nagpatulong na si Aling Rosa sa mga kapit-bahay na hanapin si Ana.

23. Tesla is also involved in the development and production of renewable energy solutions, such as solar panels and energy storage systems.

24. Yan ang panalangin ko.

25. Hun er min store forelskelse. (She's my big crush.)

26. Forgiveness is a virtue that promotes peace, healing, and a greater sense of connection with ourselves and others.

27. Jeg kan godt lide at skynde mig om morgenen, så jeg har mere tid til at slappe af senere på dagen. (I like to hurry in the morning, so I have more time to relax later in the day.)

28. A wedding is a ceremony in which two people are united in marriage.

29. Hindi siya makabangon at makagawa ng gawaing bahay.

30. Lumapit ang mga tao kay Ana at humingi ng tawad sa kaniya sa pagiging marahas ng mga ito.

31. All these years, I have been creating memories that will last a lifetime.

32. La música en vivo es una forma popular de entretenimiento.

33. Nagsmile si Athena tapos nag bow sa kanila.

34. Sa pagsasaayos ng aming barangay hall, nagkaroon kami ng malaking tagumpay dahil sa bayanihan ng mga residente.

35. AI algorithms can be used in a wide range of applications, from self-driving cars to virtual assistants.

36. Lumabas lang saglit si Genna dahil may tumawag sa kanya.

37. Ang mga bayani ay nagpapakita ng malasakit at pagmamalasakit sa kapwa tao.

38. Pagkagising ni Leah ay agad na itong naghilamos ng kanyang mukha.

39. At være transkønnet kan være en del af ens identitet, men det definerer ikke hele personen.

40. Sa gitna ng katahimikan, nakita ko siyang tulala sa kanyang pag-iisip.

41. Nagsasama-sama ang mga Pinoy tuwing Pasko para magdiwang.

42. Les écoles offrent des programmes d'apprentissage des langues pour les étudiants.

43. Nagdala si Butch ng laruan para sa bata.

44. Ang mabuting kaibigan, ay higit pa sa kayamanan.

45. Napakabuti nyang kaibigan.

46. Lügen haben kurze Beine.

47. Mahirap magsalita nang diretsahan, pero sana pwede ba kita ligawan?

48. They go to the library to borrow books.

49. The United States is a representative democracy, where citizens elect representatives to make decisions on their behalf

50. Ito ang barangay na pinamumunuan ni Datu Diliwariw.

Recent Searches

sonidoindividualnagulatlamanearlymagtatagalsecarsemarchmini-helicopterkawili-wilipaghalakhakinirapanmatalinomagtataasaktibistainaaminhandaannitomauntogkumainsupremepuwedemarielinnovationhaponlangkaypangitsayawanedsatilbinabalikgearpamumunodevicesindenalinkagipitanconventionalsingermakakatakaspublishingsiniyasatapoyformspongebobtagaytaytumagalmangyaritutorialspagkalitonai-dialvideos,tennisapatnapuresearch:storyalas-dosriegamagamotaayusinkinakainvitaminnabasasakentagumpaymag-ingatpaglayasretirarmahahabamanuscriptindependentlyalagalaamangtsinelaskambingkatolikopokerjagiyadon'tnayonnaturalhelpedelenabooksluneswikasisidlanlaruanhoywednesdayelectionnatawabotolargeproductionfencingcoalmakahingideterminasyonthemikinamataykainpagpapatubonaglalatangginugunitauugud-ugodmakapalagpronounmagbabakasyonpunongkahoyisulatnagliwanaglagaslaspumitasnangangalitnahawakanpagsalakayandrespaghangasabongcharismaticmatutongfollowinghinatidmaramotintindihinnapasubsobabut-abotkinalalagyankanyakuripotasukalininomhinalungkatmalasutlainomcrushresearch,makikipaglarovegasmagsasakametodisktrajeyakaptiningnanmaatimaksidentepalibhasapeppynamanagbasacelularesbinulongoutlinetrestapefireworksschoolstryghedseeksinverywalisprofessionalginisingoncedontleadersimaginationyanstorenuclearaminggayunpamanbringingbehindcontrolledchinesetechnologylightscourtbobomagagawarenombresinisirakinumutanmakuhangpagongmanakbotinanggalutilizarmandirigmangmasungitlihimkagabitanganbalotbagogjortautomation