Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

4 sentences found for "sonido"

1. El primer llanto del bebé es un hermoso sonido que indica vida y salud.

2. El teléfono es un dispositivo electrónico que permite la comunicación a distancia mediante el uso de señales de sonido

3. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

4. En resumen, el teléfono es un dispositivo electrónico que permite la comunicación a distancia mediante el uso de señales de sonido

Random Sentences

1. Kumalas ako sa pagkakayakap niya sa akin.

2. Microscopes can magnify objects by up to 1,000 times or more.

3. Black Widow is a highly skilled spy and martial artist.

4. Ang panaghoy ng mga manggagawa ay umalingawngaw sa buong pabrika.

5. Sadyang kaunti lamang ang alam kong mga lenggwahe.

6. Lumapit sakin si Kenji tapos naka smile siya.

7. Eine klare Gewissensentscheidung kann uns helfen, Verantwortung für unsere Handlungen zu übernehmen.

8. Lagi nating isipin na ang mga pagsubok sa buhay ay hindi dapat maging hadlang upang maipagpatuloy ang ating buhay.

9. My daughter made me a homemade card that said "happy birthday, Mom!"

10. Money is a medium of exchange used to buy and sell goods and services.

11. Different religions have different interpretations of God and the nature of the divine, ranging from monotheism to polytheism and pantheism.

12. Gusto kong malaman mo na may gusto ako sa iyo kahit na hindi ko ito masabi sa iyo nang personal.

13. The United States has a history of social and political movements, including the Civil Rights Movement and the Women's Rights Movement.

14. Twitter has a set of rules and policies to govern user behavior, including guidelines against hate speech, harassment, and misinformation.

15. May pumupunta sa Seasite minu-minuto.

16. Mabuti na lamang at nandyan ang kanyang kaibigan.

17. Gumanda ka lalo sa kulay ng suot mo.

18. Hindi matatawaran ang hinagpis ng mga magulang na nawalan ng kanilang anak sa digmaan.

19. It has revolutionized the way we communicate, allowing us to talk to people anywhere in the world at any time

20. Ipinahid ni Nanay ang gamot sa bungang-araw ng anak.

21. El agua se utiliza en actividades recreativas, como la natación, el surf y la navegación.

22. Sa bus na may karatulang "Laguna".

23. Cancer can be classified into different stages and types, which determine the treatment plan and prognosis.

24. Masaya ang buhay kapag mayroong kaulayaw na handang tumulong sa iyo.

25. Ang pagtulong sa iba ay isang halimbawa ng kabutihang-loob na pinagsisikapan ng marami na isabuhay araw-araw.

26. Gabi na natapos ang prusisyon.

27. Kebebasan beragama dijamin oleh konstitusi Indonesia dan dihormati dalam kehidupan sehari-hari.

28. Nagtapos siya sa kolehiyo noong 1990.

29. Nakapila ako sa bayad center upang magbayad ng kuryente.

30. Ang gusto sana namin ay dalawang double beds.

31. Hindi niya napigilan ang pagdila sa kanyang labi nang naglalaway siya sa pagkaing inihain sa kanya.

32. Hockey has produced many legendary players, such as Wayne Gretzky, Bobby Orr, and Mario Lemieux.

33. Virksomheder i Danmark, der eksporterer varer, er afgørende for den danske økonomi.

34. Kung gusto may paraan, kung ayaw may dahilan.

35. Nakatira si Nerissa sa Long Island.

36. Les programmes d'études sont élaborés pour fournir une éducation complète.

37. A dedicated employee goes above and beyond their job requirements to contribute to the success of their organization.

38. Pare-pareho talaga kayo mga babaero!

39. La tos convulsiva es una tos prolongada y violenta que se produce en ciclos.

40. Pinaoperahan namin siya, naging matangumpay naman ang operasyon, ngunit hindi na ito kinaya ng kanyang katawan.

41. The internet has also made it easier for people to access and share harmful content, such as hate speech and extremist ideologies

42. Sa paligid ng balde, nakikia niya ang kanyang anino.

43. Magandang maganda ang Pilipinas.

44. It can be awkward to meet someone for the first time, so I try to find common ground to break the ice.

45. The chef created a series of dishes, showcasing different flavors and textures.

46. Ano ang gustong sukatin ni Elena?

47. El Día de San Valentín es una oportunidad para demostrar el amor que sentimos por nuestras parejas.

48. Ang pagpapatingin sa dentista ay hindi lamang para sa kalusugan ng ngipin, kundi para na rin sa kabuuan ng kalusugan ng katawan.

49. Bigyan mo ng pera ang kapatid mo.

50. O sige na, sige na! Tumahan ka na lang!

Recent Searches

landesonidokinantamarmaingnakatalentvishowevermobileipapainitgrabeyangpapuntainterpretingsagingplaysaledidingsutilpressspaghettihalamanbusunoharienchanteddahonnagbentadelemanuelsumalirebolusyonnagpipilitparusalackjeromelegislativeheycongratsyescornerssinabifacebookguestsmeetitakflexibletherapymulouesparkbinigyangkalanmaalogofficechavitwowsumasambayelofurynapilingeditfallstartedefficienteffectattackmemoryfirstreturnedevolvedquicklyandreinilingsteermotionfacenariningimpithelloawarebakeendnasfaragabrucepaggawamagbibigayitaasnapakahangananlalamigmatandangwristinformationmakapagsabinasiyahanableilangtopicbumugaconventionalstaycellphonemakisuyojoshuanapakamisteryosohalagapracticadomalumbaypinagkakaguluhangamottanghaliwalonginvesthapagalindoonsmilekilongkatandaanadgangmagtigilcnicoplantastrajematigaslayawmaistorbohawaktendermalagotonkinauupuaneksenapagkaingmatamanpeepextremistusingikinabubuhaykapatawaranibinilinagpalalimkalalarobakurannaririnigpawiinpangangatawanroofstockpasyentekambingsagotkapaintupelotsakajejukamaliancompostelaclientstanodhapasinbernardoredneed,processsametelecomunicacionesisusuotsapatosvidtstraktenglishdiyanaga-agamiyerkulesedukasyonnapuyatdistanciamarasiganiniibigvetokalongriyanbinibilanganihinmagbigayanantokupuanstreetbagalshocksundhedspleje,importanteskasangkapanmagbibiyahenakaka-infotosikinamataygobernadorkaaya-ayang