Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

4 sentences found for "sonido"

1. El primer llanto del bebé es un hermoso sonido que indica vida y salud.

2. El teléfono es un dispositivo electrónico que permite la comunicación a distancia mediante el uso de señales de sonido

3. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

4. En resumen, el teléfono es un dispositivo electrónico que permite la comunicación a distancia mediante el uso de señales de sonido

Random Sentences

1. The Constitution of the United States, adopted in 1787, outlines the structure and powers of the national government

2. Kailangan mong mag-isip nang malalim upang makita mo ang kaibuturan ng kanyang problema.

3. Sa matinding sikat ng araw, tila sya ang mandirigmang sugatan, ngunit matatag na nakatindig sa pinagwagihang larangan.

4. Last full show tayo. Ano bang pinakamalapit na mall?

5. They act as a bridge between their constituents and the government, conveying concerns and advocating for necessary reforms.

6. La science environnementale étudie les effets de l'activité humaine sur l'environnement.

7. The pretty lady at the store helped me find the product I was looking for.

8. Kuripot daw ang mga intsik.

9.

10. Nagbabaga ang damdamin ng bayan matapos ang mainit na balita tungkol sa katiwalian.

11. The potential for human creativity is immeasurable.

12. Lumipad palayo ang saranggola at hindi na nila nakita.

13. Limitations can be frustrating and may cause feelings of disappointment and failure.

14. Boboto ako sa darating na halalan.

15. Der er også mange forskellige former for motion, som kan udføres uden nogen speciel udstyr, såsom gåture og trappetrin træning.

16. Ang paglapastangan sa mga batas at regulasyon ay nagdudulot ng kawalan ng disiplina sa lipunan.

17. Elle adore les films d'horreur.

18. Adequate fiber intake can help regulate the digestive system and maintain gut health.

19. I can't keep it a secret any longer, I'm going to spill the beans.

20. Nakalimutan kong magdala ng flashlight kaya nahirapan akong makita sa pagdidilim ng gubat.

21. Tom Cruise is a highly successful actor known for his roles in movies like "Top Gun" and the "Mission: Impossible" series.

22. Ang nagbabago ay nag-iimprove.

23.

24. If you think I'm the one who stole your phone, you're barking up the wrong tree.

25. Ang taong may mabuting asal, magpapakilala sa kanyang bayan.

26. Many celebrities and public figures have joined TikTok to connect with their fans in a more personal way.

27. Pagtitinda ng bulakalak ang kanilang ikinabubuhay.

28. Minsan, ang pag-iisa ay maaaring maging magandang oportunidad para mag-isip at magpahinga.

29. Walang puno ang hindi hitik sa bunga.

30. Ganun ba talaga kalaki yung impact ng pananakot ko sa kanya?

31. Nagkatinginan ang mag-ama.

32. In addition to his martial arts skills, Lee was also known for his philosophical ideas and his emphasis on personal development

33. The website's search function is very effective, making it easy to find the information you need.

34. Lee's influence on the martial arts world is undeniable

35. A través de la música, las personas expresan sus emociones, comparten sus historias y conectan con los demás

36.

37. Hindi ko gusto ang kanyang maarteng pananalita tungkol sa kanyang pagkain.

38. Agosto pa lamang ay may mga pang paskong dekorasyon na sa mga malls.

39. Yeah. masayang sabi ni Chad with matching thumbs up.

40. Cryptocurrency has the potential to disrupt traditional financial systems and empower individuals.

41. Olympic athletes demonstrate incredible dedication through years of rigorous training and sacrifice.

42. Additionally, it has greatly improved emergency services, allowing people to call for help in case of an emergency

43. Foreclosed properties can be a good option for first-time homebuyers who are looking for a bargain.

44. Naglalaba si Maria ng mga damit tuwing Linggo para sa buong pamilya.

45. Mens nogle mennesker kan tjene penge ved at gamble, er det en risikabel investering og kan ikke betragtes som en pålidelig indkomstkilde.

46. Bagaimana kondisi cuaca di sana? (What is the weather condition there?)

47. The baby is sleeping in the crib.

48. Put all your eggs in one basket

49. Sa sobrang pagod, nagawa niyang paglimot sa mga pangyayari ng nakaraang araw.

50. Ang pagtulong sa iba o pagbibigay ng serbisyo ay isang nakagagamot na karanasan na nagbibigay ng tunay na kaligayahan.

Recent Searches

lalosonidoconsumenagpuntamakahingipasswordkahilingannalalagasisipubodelvisbitiwandaangusodietsalahehebukodeffektivtinanggapingatanmerrybarrocolegislationestablishbobosumaboglamesapostcardipanlinismagpuntasakinmedievalnamcollectionsmodernnatanggapworrysumalamapakalideleminutepookpulacebureservationdrayberdatapwateeeehhhhguestsmalinisknow-howthenchadbugtongbokasinpagetrafficcalleripagamottodayguiltynariningfacethoughtsitlogreadingevilipongtalefredsafeclientesbitawanitinuringhimselfviewsimprovemovingartificialspeechclearinternetprogramavisualmakapilingclockcuandowaitsalapieditcontrolledpacethreeremotegapcableuniquehelloservicesalignsnegativeimprovedcircleenteraggressionnakatulogstatingarturobumibitiwpinapakiramdamanpagkakatayogumagalaw-galawnahawakansikre,filmskills,pinakabatangbumalikhoneymoonmaliwanaghayaanhitasasagutinumangatpinangaralanmagagamitlumilipadpigilannagbibigayantsismosadepartmentkasisystematiskdalawangmakausapcandidatessabongo-onlinetagumpaykuyadeletingtsuperlayuanbinilhanadoptedmukaoutlinetuwangfurgatheringkerbflexiblelatehigitkabibilayout,moreellenprofessionalmoviecomputerestageimagingideayesmahiwagadioxideprogramsefficientaffectilingnagliliwanagmag-ibanakahigangagricultoresmahahanaymirapagkahapopamamalakadnageespadahanaktibistasakristanunahintagaytaynalakinakikianabasaganapinmauuporacialumilinginspirationpagpalitparusahanmag-aaralrockcupidbeinte