Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

4 sentences found for "sonido"

1. El primer llanto del bebé es un hermoso sonido que indica vida y salud.

2. El teléfono es un dispositivo electrónico que permite la comunicación a distancia mediante el uso de señales de sonido

3. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

4. En resumen, el teléfono es un dispositivo electrónico que permite la comunicación a distancia mediante el uso de señales de sonido

Random Sentences

1. Ok na sana eh. Tinawanan pa ako.

2. Eating small, healthy meals regularly throughout the day can help maintain stable energy levels.

3. The role of a father has evolved over time, with many fathers taking on more active roles in child-rearing and household management.

4. The doctor advised him to get plenty of rest and fluids to recover from pneumonia.

5. Air tenang menghanyutkan.

6. I don't eat fast food often, but once in a blue moon, I'll treat myself to a burger and fries.

7. Inilagay nya sa poon ang biniling sampaguita.

8. The relationship between work and mental health is complex and can vary from person to person.

9. Ang takip-silim ay isang panahon kung saan maaari mong maappreciate ang ganda ng kalikasan at ng mga gusali.

10. Elektronisk udstyr kan hjælpe med at optimere produktionsprocesser og reducere omkostninger.

11. The intensity of baby fever can vary from person to person, with some feeling a passing longing and others experiencing a persistent and overwhelming desire.

12. Kinuha ko yung CP ko at nai-dial ang number ni Joy.

13. Las pinceladas sueltas y rápidas le dan a la pintura un aspecto más dinámico.

14. Sa droga, walang kasiguraduhan kundi kamatayan.

15. Naririnig ko ang halinghing ng mga kalahok sa obstacle course race.

16. Para aliviar un resfriado, puedes hacer una infusión de hierbas como el eucalipto y la manzanilla.

17. Arbejdsgivere leder ofte efter erfarne medarbejdere.

18. Kailan po kayo may oras para sa sarili?

19. Hindi ito maganda na maging sobrang takot sa lahat ng bagay dahil lamang sa agam-agam.

20. Huwag daw niyang papansinin si Ogor.

21. Ayos lang yun. May nagsabay naman sa akin eh. sabi ko.

22. The 10th Amendment of the Constitution outlines this division of power, stating that powers not delegated to the national government are reserved for the states

23. Sa mga lugar na may tag-ulan, kadalasang mas madalas magkasakit ang mga tao dahil sa mas mabilis na pagkalat ng mga sakit sa panahon ng malakas na ulan.

24. Einstein was offered the presidency of Israel in 1952, but declined the offer.

25. Some coffee enthusiasts enjoy collecting different types of coffee beans and brewing methods to explore the variety of flavors and aromas that coffee has to offer.

26. It's important to maintain a good credit score for future financial opportunities.

27. Paano kung hindi maayos ang aircon?

28. Kasama ko ang aking mga magulang sa pamanhikan.

29. The victim was able to identify the culprit who had been harassing them for months.

30. Ano ang ginagawa niya sa gabi?)

31. Naging biktima ng agaw-buhay na pagnanakaw ang kanyang pamilya.

32. Gusto ko nang kumain, datapwat wala pa akong pera.

33. Masayang kasayaw ng mga Kuneho ang mga Usa, ng mga Elepante ang mga Tamaraw, ng Zebra ang Tsonggo.

34. Las redes sociales pueden ser adictivas y consumir mucho tiempo.

35. Nasa Montreal ako tuwing Enero.

36. Mga mangga ang binibili ni Juan.

37. Maarte siya sa mga lugar na pupuntahan kaya hindi siya nakikipagsiksikan sa mga madaming tao.

38. However, it is important to note that excessive coffee consumption can also have negative health effects, such as increasing the risk of heart disease.

39. Narinig ko ang hinagpis ng mga magsasaka dahil sa mababang presyo ng kanilang ani.

40. Durante las vacaciones, me gusta relajarme en la playa.

41. In 2014, LeBron returned to the Cleveland Cavaliers and delivered the franchise's first-ever NBA championship in 2016, leading them to overcome a 3-1 deficit in the Finals against the Golden State Warriors.

42. Tinuro nya yung box ng happy meal.

43. Don't count your chickens before they hatch

44. May salbaheng aso ang pinsan ko.

45. Tumayo siya tapos nagmadaling pumunta sa cr

46. Ang bayanihan ay nagpapalakas ng samahan at pagkakaisa sa aming pamayanan.

47. Hintayin mo ko.. Kahit anong mangyari hintayin mo ko..

48. Every year on April Fool's, my dad pretends to have forgotten my mom's birthday - it's a running joke in our family.

49. Forgiveness is a gift we give ourselves, as it allows us to break free from the chains of resentment and anger.

50. Masayang-masaya ako ngayon dahil nakapasa ako sa board exam.

Recent Searches

kasakitmatuliskalongdibasikoparinsonidonatagalanmaistorboyeyipagbiliredessumamaleytetaingashopeelosswordbusyanglutomallnilinisbukaroseitakjacecoatmemorialdevelopedconectadospagbahingimaginationcongratschavitideyamatatalimpintonagbibigaybumangontargetdaddyflooroperatedahongamesellennagingrolledtekstbellpalagingalintuntunindenmangingisdangownactorsyncstringdecreasebaldedosmonetizingnotebookamazonimprovedinternetexitconnectionnakakaanimmagdamaganibinaonmakinangbalatganoonnananaghilitreatsprimerosbugtongwellmagagalingo-orderkokakcoaching:polocheckstumalonpahirapanatagiliranonline,tinahakeuropegawaingumabotmataasmalumbaydiseaseskatutuboyongopisinasiguromalambingbasahinpunongkahoynagmakaawathankwantspiritualanywheretawadpostermagbabakasyongasolinahanhanconventionalniyonlaybrariogorpalantandaanbabespartmagpaniwalamagkakaanakpagkamanghanakatuwaangnakakatawanakabulagtanglaki-lakinag-oorasyonpinagmamalakiagwadorpinakamaartengfinalized,batomagtiwalahouseholdsbumisitanagdiretsonakapasokuusapanmagkaibangnagsisigawmakitasalepanghihiyangikinalulungkotkinagalitannakalockhululumibotkaklasekulunganitinatapatmahiwaganamataypangungusapibinilibrancher,guitarranakakatabapanalanginibinubulongmamayangmakapilingkaratulangkapitbahaypictureskampeonkristokulturpapuntangsisikatnapilipatawarinnangapatdanintramurosnakilalakabiyakpamagatnatayoexperience,maskinermatutongsahiglilikodiliginbibilhinpangakokapatagankarapatangpinabulaanna-curiousguerreropapalapitnapapatingintsinelasmaubosbutiilagayinastagjort