Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

4 sentences found for "sonido"

1. El primer llanto del bebé es un hermoso sonido que indica vida y salud.

2. El teléfono es un dispositivo electrónico que permite la comunicación a distancia mediante el uso de señales de sonido

3. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

4. En resumen, el teléfono es un dispositivo electrónico que permite la comunicación a distancia mediante el uso de señales de sonido

Random Sentences

1. Ang mga pag-aaral sa kalusugang pang-mental ay nagbibigay-diin sa kahalagahan ng kamalayan sa mga isyu ng mental na kalusugan.

2. Bumangon ka nga jan! Saka paano ka nakapasok!

3. Mabuti na lamang ay sinunod nya ang alituntunin ng kanilang paaralan.

4. La alimentación equilibrada y una buena hidratación pueden favorecer la cicatrización de las heridas.

5. Ano ang ginagawa niya sa gabi?)

6. The elderly man was happy sitting on his porch, watching the world go by - sometimes ignorance is bliss in old age.

7. Algunos músicos famosos incluyen a Mozart, Beethoven y Michael Jackson.

8. My coworker was trying to keep their new job a secret, but someone else let the cat out of the bag and the news spread like wildfire.

9. La agricultura sostenible es una práctica importante para preservar la tierra y el medio ambiente.

10. Karaniwan sa kasal, mayroong seremonya ng pamamahagi ng singsing at pagbibigay ng halik sa asawa.

11. Gusto kong manood ng sine bukas, bagkus magbabasa ako ngayon ng libro.

12. "Dogs leave paw prints on your heart."

13. Ipinambili niya ng damit ang pera.

14. We need to address the elephant in the room and discuss the budget issues.

15. Les médicaments peuvent aider à traiter de nombreuses maladies, mais doivent être utilisés avec précaution.

16. Ang ganda ng bagong laptop ni Maria.

17. One of the most significant areas of technological advancement in recent years has been in the field of communications

18. Hindi ko akalaing capable ka palang tumawa.

19. Emphasis is an important component of artistic expression, such as in poetry and music.

20. This has led to increased trade and commerce, as well as greater mobility for individuals

21. Ako ngayo'y lumilipad at nasa langit na.

22. The telephone is a device that allows people to communicate over long distances by converting sound into electrical signals and transmitting them through a network of wires or wireless connection

23. The new restaurant in town is absolutely worth trying.

24. Millard Fillmore, the thirteenth president of the United States, served from 1850 to 1853 and signed the Compromise of 1850, which helped to delay the outbreak of the Civil War.

25. Panahon na lang ang hahatol kung nararapat na ngang ibalik sa dating anyo si Kiko.

26. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

27. Di kalaunan, habang lumalaki ang bata, napapansin nilang ito nagiging salbahe, napakasinungaling at maramot.

28. Kay hapdi ng kanyang batok at balikat.

29. Sila ang mga tunay na tagapagtanggol ng kalayaan at karapatan ng mamamayan.

30. Scissors should be handled with care to avoid injuries and kept out of reach of children.

31. Nagkaroon sila ng maraming anak.

32. Mas mainit sa Pilipinas kaysa dito.

33. Arbejde er en vigtig del af voksenlivet.

34. Påsken er også en tid, hvor mange familier samles og fejrer sammen.

35. La crisis económica produjo una gran inflación que afectó a los precios.

36. No deberías estar llamando la atención de esa manera.

37. Napaiyak ako dahil sa pelikula.

38. Sa pag-aaral, mas nagiging matiwasay ako kapag maayos ang aking mga talaarawan.

39. The website's online store has a great selection of products at affordable prices.

40. The impact of the pandemic on mental health has been immeasurable.

41. She has been teaching English for five years.

42. Nakikita si Carlos Yulo bilang inspirasyon ng maraming kabataang Filipino.

43. Two heads are better than one.

44. Hindi ibibigay ng Panginoon sa iyo ang isang pagsubok kung hindi mo ito kaya, magtiwala at maniwala ka lang sa Kanya.

45. The stock market can provide opportunities for diversifying investment portfolios.

46. Nakangiti siya at ang babae ay ngumiti rin.

47. Mabait ang nanay ni Julius.

48. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

49. L'intelligence artificielle peut aider à la conception de médicaments plus efficaces.

50. Dahil sa maling pagdisiplina, naglipana ang mga pangit na gawi sa lipunan.

Recent Searches

sonidobakantemalikotbutonakatuonpinauwibantulotmayrooncellphonecebuauditkamihumanapfestivaleskapasyahansinasadyamag-inanakikiaiintayinnalagutanhimayinbalinganmadalingbuwayaeleksyonfederalforskelkapalbakanahantadnangingilidpesoubuhinmaibigaysunud-sunodisinarapinagkaloobannakikini-kinitanamumukod-tanginapakamisteryosogumagalaw-galawnakapaglarotahimikkolehiyomensahearbularyopumitasbarongpresidentialkinamumuhiannagbabakasyonbarung-barongpagbabagong-anyofactorespinipilitalagangsugatangvidtstraktperpektingmarketing:nanonoodsuchfranciscobowlmagagamitmasyadongkanginalondonintensidaddekorasyonbuung-buomakahiramnauponagpaalamnaka-smirkkaloobangreguleringmalambinglovecombinedseniorsikoalamidsumigawpananakitdisensyotanyagkabighakalabantumingalamatagumpayagam-agamdailymagkasinggandakaarawannataposkarapatanrisecolortunaykainanpinoyrecibirpangakoperseverance,laganapmaligayaantespresleysilyanenahagdanbundokexpresano-ordersuwailbawalgayunpamandinamparoipatuloyprinceletterbutihingpulubiaumentarmakasarilingcakeumilinghalagadividesagecallinterpretingmagingdiwataexpectationsfeelingsulingansutilrateadvancedagoskamaocoachinghallspendinggranmuchaskumukuhazoomlargerduonaddingberkeleystringsalatinbasaactorgenerationspagpapakalatmatalimkusineroteachhubad-baroskillsawitmag-amaaminpresyobukasmaygirlgrammarlaylaycramedumagundongmaongkasabayokaypasigawmag-usapmapuputiopisinasalonpinagmamasdannaturtig-bebenteprodujotumawanananalongnailigtaskungpangilnagbasamagkakagustokapatawarannaglalatangmagnifypatong