Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

4 sentences found for "sonido"

1. El primer llanto del bebé es un hermoso sonido que indica vida y salud.

2. El teléfono es un dispositivo electrónico que permite la comunicación a distancia mediante el uso de señales de sonido

3. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

4. En resumen, el teléfono es un dispositivo electrónico que permite la comunicación a distancia mediante el uso de señales de sonido

Random Sentences

1. Shows like I Love Lucy and The Honeymooners helped to establish television as a medium for entertainment

2. Kuwartong pandalawahan, hindi ho ba?

3. Einstein was awarded the Nobel Prize in Physics in 1921 for his discovery of the law of the photoelectric effect.

4. The development of vaccines and antibiotics has greatly reduced the incidence of infectious diseases, while the use of medical imaging and diagnostic tools has improved the accuracy and speed of diagnoses

5. El agricultor cultiva la tierra y produce alimentos para el consumo humano.

6. Ang sugal ay isang hindi maiprediktable na aktibidad na nagdudulot ng excitement at thrill sa mga manlalaro.

7. Pakipuntahan mo si Maria sa kusina.

8. Walang humpay ang pagdudugo ng sugat ng tigre kaya agad agad itong kumaripas ng takbo palayo sa kweba.

9. Seeing a long-lost friend or family member can create a sense of euphoria and happiness.

10. Napapatungo na laamang siya.

11. He preferred a lightweight moisturizer that wouldn't feel heavy on his skin.

12. Tengo muchos sueños y aspiraciones. (I have many dreams and aspirations.)

13. Kahit saan man ako magpunta, hindi ko makakalimutan ang aking kaulayaw.

14. Kailangan nating magtiyaga at magsumikap sa ating mga pangarap, datapapwat ay hindi ito agad-agad natutupad.

15. Paki-bukas ang bintana kasi mainit.

16. Ang laki ng gagamba.

17. Siya ay nagdesisyon na lumibot sa paligid ng bayan upang makakuha ng impormasyon para sa kanyang proyektong pang-eskwela.

18.

19. Mukha namang pangkaraniwan lang ang matanda at baka nga hindi pa nito alam kung paano humabi.

20. He has been playing video games for hours.

21. Halos anim na oras silang naglakad paakyat ng bundok makiling.

22. It's important to consider the financial responsibility of owning a pet, including veterinary care and food costs.

23. The company's losses were due to the actions of a culprit who had been stealing supplies.

24. The company's acquisition of new assets will help it expand its global presence.

25. The scientist conducted a series of experiments to test her hypothesis.

26. Ang pagtulog ay isang likas na gawain na kinakailangan ng bawat tao para sa kanilang kalusugan.

27. Ang talakayan ay ukol kay Dr. Jose Rizal at sa kanyang mga kontribusyon sa bansa.

28. No hay nada más poderoso que un sueño respaldado por la esperanza y la acción. (There is nothing more powerful than a dream backed by hope and action.)

29. Te llamaré esta noche para saber cómo estás, cuídate mucho mientras tanto.

30. The invention of the telephone and the internet has revolutionized the way people communicate with each other

31. At habang itinatapat nito ang balde sa gripo, muli niyang nakita na nginingisihan siya nito.

32. Ang kanyang mga salita ay nagbabaga ng inspirasyon sa mga nakikinig.

33. The website's loading speed is fast, which improves user experience and reduces bounce rates.

34. Kailan niya kailangan ang kuwarto?

35. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

36. Los padres pueden elegir tener un parto en casa o en un hospital, dependiendo de sus preferencias y necesidades.

37. Ang tarangkahan ay gawa sa matibay na kahoy at bakal.

38. I am not watching TV at the moment.

39. In the dark blue sky you keep

40. Parating na rin yun. Bayaan mo siya may susi naman yun eh.

41. Sa aming pagsasaliksik, nagkaroon kami ng maraming mungkahi upang mapabuti ang aming eksperimento.

42. Maaari mo ng bitawan ang girlfriend ko, alam mo yun?

43. Tumawag ang pamilya ng albularyo upang gumaling ang kanilang kamag-anak mula sa misteryosong sakit.

44. "Ang oras ay ginto" ay isang bukambibig na nagpapahiwatig ng halaga ng paggamit ng oras nang maayos at wasto.

45. The stock market is a platform for buying and selling shares of publicly traded companies.

46. Pumunta sila sa Zamboanga noong nakaraang taon.

47. They may draft and introduce bills or resolutions to address specific concerns or promote change.

48. The Lakers have had periods of dominance, including the "Showtime" era in the 1980s, when they were known for their fast-paced and entertaining style of play.

49. Mabuti na lang at hindi ako nauntog sa bubong ng dyip.

50. The pretty lady walking down the street caught my attention.

Recent Searches

jagiyaartistssonidohallpalitankenjisinklumiwanagabanganpapelkabighapopularizepwedengbantulotthereforemoodnabigyankruspagodadoptedparagraphsnagbiyahetog,kaninapupuntaidea:gawingobservation,mahigpittanodbuwalmaputinalalabingpakisabihuwebesbilipitumpongcebuilansabadmedicinenagbigayansisentaamericanbuslomagasawangcnicokapangyarihangkarwahenghumalogumagalaw-galawbrasopalabuy-laboylandaskukuhaperformancesorepatakboamazoninferioresmukhangpatutunguhanmasayamatigasipapainitbagkussalbahengakmangmaduras1980natabunansalu-salonagbibigaymakatio-orderbarkoklasengnaghanapmamiboholnagsineoffernetflixrailwayspsssbwahahahahahamaluwangarghmainitdemocracypakibigyannapatayointeresthistoriakomedorwidelynahulaaniskoangkannatalongmini-helicopteragosnagreklamomagpa-ospitallendingnawalangabrilsiniyasattatlumpungnagkasakitpampagandacarlosabernagtutulaknitongmagagamitberetirewardingyonlabinsiyamsumalapalagingnagugutomibinaonatensyongsinundanpumulotnagagamitchefanimutilizarexpertisepangakoalmacenarmalikottumindigpinalayasmakapalsarilimbricoshojasluisworkingwaringpamimilhinganywherecubicleresearch:badingmagtipidbreakchadaffectnumbersumimangotdevelopmentsnathoughtsprogramacomputerepeternagcurveapollolumakipublishedaplicacionesjuanabenesmallobtenerpalavariedadnaglalaronapawiklimanamumulotmanagerespadanagkapilatkaarawanpag-ibigtiningnanhjemstedskabtmisteryomanonoodbinasaflyvemaskinerperpektingkabutihaninimbitainformedkakuwentuhankailannapigilandelasugalnarooninastaeroplano