Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

4 sentences found for "sonido"

1. El primer llanto del bebé es un hermoso sonido que indica vida y salud.

2. El teléfono es un dispositivo electrónico que permite la comunicación a distancia mediante el uso de señales de sonido

3. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

4. En resumen, el teléfono es un dispositivo electrónico que permite la comunicación a distancia mediante el uso de señales de sonido

Random Sentences

1. The momentum of the wave carried the surfer towards the shore.

2. Napadungaw siya sa entablado at nagulat sa dami ng taong nanood ng kanilang palabas.

3. Ipinanganak si Emilio Aguinaldo noong Marso 22, 1869, sa Kawit, Cavite.

4. No puedo cambiar el pasado, solo puedo aceptarlo con "que sera, sera."

5. The number you have dialled is either unattended or...

6. Skærtorsdag mindes Jesu sidste nadver med sine disciple, før han blev taget til fange.

7. Libro ko ang kulay itim na libro.

8. Los blogs y los vlogs son una forma popular de compartir información en línea.

9. Humayo kayo at magpakarami! ayon ang biro ni Father Ramon.

10. If you think I'm the one who stole your phone, you're barking up the wrong tree.

11. Naka color green ako na damit tapos naka shades.

12. Mens online gambling kan være bekvemt, er det også vigtigt at være opmærksom på de risici, der er involveret, såsom snyd og identitetstyveri.

13. The United States also has a system of governors, who are elected to lead each individual state

14. El sismo produjo una gran destrucción en la ciudad y causó muchas muertes.

15. Unti-unting lumapad yung ngiti niya.

16. Hindi nawawala ang halaga ng panitikan sa pagpapalaganap ng kultura at kaalaman, kaya't ito ay mahalaga sa buhay ng mga tao.

17. El nacimiento de un hijo cambia la dinámica familiar y crea un lazo fuerte entre los miembros.

18. Nagsusulat ako ng tula bilang pagpapahayag ng aking damdamin.

19. May bukas ang ganito.

20. La realidad es que necesitamos trabajar juntos para resolver el problema.

21. He does not argue with his colleagues.

22. Hindi ho ba madilim sa kalye sa gabi?

23. Martabak adalah makanan ringan yang terbuat dari adonan tepung dan isian kacang, daging, atau keju.

24. Nagtaas na naman ng presyo ang gasolina.

25. Good afternoon po. bati ko sa Mommy ni Maico.

26. It's a piece of cake

27. Magandang gabi sa inyo mga ginoo at binibini.

28. The basketball court is divided into two halves, with each team playing offense and defense alternately.

29. Napakabilis ng wifi sa kanilang bahay.

30. Baro't saya ang isusuot ni Lily.

31. The most famous professional hockey league is the NHL (National Hockey League), which is based in the United States and Canada.

32. Naglahad ng mga hindi inaasahang pangyayari ang kabanata, na nagdulot ng tensyon at kawalan ng tiwala sa pagitan ng mga karakter.

33. Naging kaulayaw ko siya noong ako'y nag-aaral pa lamang.

34. Napag desisyonan ko na. Love is sacrifice, right?

35. We were planning on going to the park, but it's raining cats and dogs, so we'll have to stay indoors.

36. He has been repairing the car for hours.

37. Oscilloscopes come in various types, including analog oscilloscopes and digital oscilloscopes.

38. Sama-sama. - You're welcome.

39. Aling lugar sa lungsod mo ang matao?

40. Bawat pamilya ay may magarang tarangkahan sa kanilang mga tahanan.

41. Rutherford B. Hayes, the nineteenth president of the United States, served from 1877 to 1881 and oversaw the end of Reconstruction.

42. Siya ay hinugot ng mga pagsubok sa buhay ngunit hindi siya sumuko.

43. Nandito ako sa mall. Trip lang, ayoko pang umuwi eh.

44. Los héroes defienden la justicia y luchan por los derechos de los demás.

45. In recent years, the Lakers have regained their competitive edge, with the acquisition of star players like LeBron James and Anthony Davis.

46. Bell's invention was based on the idea of using electrical signals to transmit sound, which was a new concept at the time

47. Helte kan være en kilde til håb og optimisme i en verden, der kan være svær.

48. Coffee has a long history, with the first known coffee plantations dating back to the 15th century.

49. The little boy was happy playing in his sandbox, unaware of the problems of the world - ignorance is bliss when you're that age.

50. Simula nung gabing iyon ay bumalik na ang sigla ni Nicolas at nagsimula na siyang manilbihan sa Panginoon

Recent Searches

magtipidlegacysonidokindsmalikotnahihilonuhilocoscoinbasekaibigannakasuotsinimulanhojaslegislationcupidlordasulstaplecomputere,inompepehydelbuwaltingelectionsdamitcebunatanggapkamatiscryptocurrency:criticsbinigaynatuloykanyangaltagosvedinaloknerocommunicationsluisdontpasokpaghabanagbungacouldactionoffentligfigurenerissamonetizingbulsadaratingtipidupworkdarkformatumaggapwindowfutureformscomputerincludereleasedsummitcirclecontrolaknowsystemrawnagaganaptotoongtinaasunconventionalmisyuneroticketabletotookisapmatakuwadernonasulyapanriyanmisteryopakistanpanunuksongconventionalnohmagtataasniyonpaglapastangannageenglishsalarinkapaggrewwatchparticipatingtulongevolvediinmasayangdalawinmagkasabaydiwataltomanuksosongsnakafartilagagamitintanyagkawili-wilipaglalabaunapodcasts,hitsuradatinginaaminlalabascomenawalabutchmagpapaikotsearchnasirabusinessesmakapangyarihangeksaytedcrushprimerosbuhawinangyarinakaangatmerenakasakitnagreplyikinakagalitmaynilaatnakakatabanasaanhinihintaykumaripasmaynilapaliparinumuuwiguhithunilalakepagkapasanwastekumbentonailigtassittingnagbabagamatandamarmaingiilanwhateverdulotharibinilingnaggingroquenatanongpayatpatutunguhansasamahanpakanta-kantangkumbinsihinnakaupokinatatalungkuangpagpasensyahanclubnanahimikagam-agammagsusunurankuwartotiniradorfilmkapangyarihangnagsisigawgalawnadamanagmistulangmakatatlomorningkanikanilangpakikipagbabagpinamalagipagkabuhayinilalabasnasasabihanbrancher,ninanaispagbabayadkinalilibingannangahasstrategieskalaunantanggalin