Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

4 sentences found for "sonido"

1. El primer llanto del bebé es un hermoso sonido que indica vida y salud.

2. El teléfono es un dispositivo electrónico que permite la comunicación a distancia mediante el uso de señales de sonido

3. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

4. En resumen, el teléfono es un dispositivo electrónico que permite la comunicación a distancia mediante el uso de señales de sonido

Random Sentences

1. La motivation peut être influencée par la culture, les valeurs et les croyances de chacun.

2. Elektronik kan hjælpe med at forbedre sikkerhed og beskyttelse af data.

3. Sueño con tener un estilo de vida saludable y activo. (I dream of having a healthy and active lifestyle.)

4. The stock market gained momentum after the announcement of the new product.

5. Dahil sa pagkahapo ay nahiga siya sa lilim ng punung-kahoy para magpahinga.

6.

7. I'm so sorry. di makaling sabi niya habang nakatitig dun.

8. Nakakainis ang mga taong nagpaplastikan dahil hindi mo alam kung totoo ba ang sinasabi nila.

9. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

10. He has written a novel.

11. Ang pasaway na estudyante ay na-suway nang paulit-ulit ng kanyang guro.

12. She began her career in musical theater and appeared in the Broadway production 13 in 2008.

13. The Galapagos Islands are a natural wonder, known for their unique and diverse wildlife.

14. Bata pa lang si Tony nang iwan sya ng kanyang ama

15. Puwede magdala ng radyo ang kaibigan ko.

16. Algunas serpientes son capaces de desplazarse en el agua, mientras que otras son terrestres o arbóreas.

17. Ang magnanakaw ay nakunan ng CCTV habang papalapit ito sa tindahan.

18. Sa probinsya, maraming tao ang naglalaba sa ilog o sa bukal.

19. Después de la clase de yoga, me siento relajada y renovada.

20. Ang tindahan ay nasara dahil sa paulit-ulit na pag-suway sa business regulations.

21. Gusto ko na talaga mamasyal sa Singapore.

22. Eh gaga ka pala eh, gag show mo mukha mo.

23. Einstein was a pacifist and advocated for world peace, speaking out against nuclear weapons and war.

24. Ang paggamit ng droga ay maaaring magdulot ng pagkakaroon ng mga karamdaman, tulad ng mga sakit sa puso, kanser, at mga problema sa paghinga.

25. Ang sugal ay maaaring maging isang malaking hadlang sa pag-unlad at pag-abot ng mga pangarap sa buhay.

26. Cryptocurrency wallets are used to store and manage digital assets.

27. Pumupunta ako sa Laguna tuwing Mayo.

28. The photographer captured a series of images depicting the changing seasons.

29. The tree provides shade on a hot day.

30. Nakakasama sila sa pagsasaya.

31. Les mathématiques sont une discipline essentielle pour la science.

32. L'auto-discipline est également importante pour maintenir la motivation, car elle permet de s'engager dans des actions nécessaires même lorsque cela peut être difficile.

33. Huwag daw siyang makikipagbabag.

34. Lasinggero ang tatay ni Gabriel.

35. I don't usually go to the movies, but once in a blue moon, there's a film that I just have to see on the big screen.

36. Mi amigo me enseñó a tocar la guitarra y ahora podemos tocar juntos.

37. Nagpaluto ako ng spaghetti kay Maria.

38. Hindi ko kayang hindi sabihin sa iyo, sana pwede ba kitang mahalin?

39. Cutting corners on food safety regulations can put people's health at risk.

40. May problema ka sa oras? Kung gayon, subukan mong gumawa ng iskedyul.

41. Paano siya pumupunta sa klase?

42. Pour maintenir sa motivation, il est important d'avoir des objectifs clairs et réalisables.

43. Hihiga na sana ako nang may kumatok sa pinto.

44. Los héroes pueden ser encontrados en diferentes campos, como el deporte, la ciencia, el arte o el servicio público.

45. Ang pag-asa ay nagbibigay ng positibong pagtingin sa buhay at mga pangyayari kahit na may mga suliranin at pagsubok na kinakaharap.

46. All these years, I have been overcoming challenges and obstacles to reach my goals.

47. Transkønnede personer har forskellige oplevelser af deres kønsidentitet og kan have forskellige præferencer og behov.

48. At leve med en tung samvittighed kan føre til søvnløshed og andre sundhedsproblemer.

49. Naalala nila si Ranay.

50. Hindi na niya makuhang laruin ang beyblade bagamat ayaw niya itong bitiwan sa loob ng kaniyang kamay o di kaya'y bulsa.

Recent Searches

sonidobalangpanindanginihandasumasakitpatunayanbalitanggumulongtinapayngangfinishedteleviewingmakisigkantoduonpitobotantelettermrsupolaryngitismakasarilingcitizenlandoganapagkabatafreelancing:amongdinukotbeautifulilanzoomotrasmaalogmuntikanbataypakelammalagooverallaccederbinibininatanggapbosscompostelapinyafuemakapasokbangakaninangnashadlangpahingafamestylestag-arawnapohigupinpededelenakakapagtakapulawellearlytransparentcebuspendinggodjackzlarry1973pinggankumaripaslindolikinabitdinaladividesdercrossipapahingaflyinterpretingplatformsobstaclescallactingauditsincesutilkurakotmapdeveloptipiginitgitconvertingayanipinalutofacebroadcastsbringingmonetizingblesssuchibapakelameroakalaspillnagbuwisgabi-gabinaiilangmagsusuottinawagpumasokikukumparapagkapasoknaibibigayt-isatissuemagitingnobelacynthianatinagwinepagkabuhaysinabinagpapaigibkasaganaanunibersidadpinagkaloobaninutusanmay-bahaypag-iwantuluyangkilalang-kilalasultantaongcalambablazingvaliosalikasdireksyonbilihinumiisodmasaholsalbahengspeechmandirigmangkanayangcommercialincrediblemasungitendvideretubigpakaininsementobunutanengkantadamawalavegaspinaggagagawanitosistemakawalactivitymag-asawaganuncashcalidadkatulongillegalkaraniwangbayangmalaki-lakimababatidsocialebumabalotpondosantosbuwayarolandmerchandisegjortmagbasabanyokasaldeterminasyonexpresanhoytagaroontugontag-ulanearnpsssaksidentemaidtiningnankarangalanmatigasmongpasigawmatapos