Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

4 sentences found for "sonido"

1. El primer llanto del bebé es un hermoso sonido que indica vida y salud.

2. El teléfono es un dispositivo electrónico que permite la comunicación a distancia mediante el uso de señales de sonido

3. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

4. En resumen, el teléfono es un dispositivo electrónico que permite la comunicación a distancia mediante el uso de señales de sonido

Random Sentences

1. Anong panghimagas ang gusto nila?

2. Nakahain na ako nang dumating siya sa hapag.

3. She has quit her job.

4. Los Angeles, California, is the largest city on the West Coast of the United States.

5. Sumakay kami ng kotse at nagpunta ng mall.

6. With the introduction of television, however, people could now watch live events as they happened, and this changed the way that people consume media

7. Nanghiram ako ng pera sa kaibigan ko para may panggastos sa kape.

8. Regelmæssig motion kan forbedre hjerte-kar-systemet og styrke muskler og knogler.

9. La realidad a veces es cruel, pero debemos enfrentarla con valentía.

10. makaraan ang ilang sandali, dahan-dahan at nanlalambot siyang tumindig, nakatuon ang mga mata kay Ogor.

11. Musk was born in South Africa and later became a citizen of the United States and Canada.

12. Iwanan kaya nila ang kanilang maruming bayan?

13. Das Gewissen ist unsere innere Stimme, die uns sagt, was richtig und falsch ist.

14. Huh? umiling ako, hindi ah.

15. El arte puede ser utilizado para fines políticos o sociales.

16. I heard that the restaurant has bad service, but I'll take it with a grain of salt until I try it myself.

17. Ang pag-aaksaya ng pera sa sugal ay isang hindi maipapaliwanag na desisyon.

18. We have been cooking dinner together for an hour.

19. Facebook allows users to send private messages, comment on posts, and engage in group discussions.

20. "Wag kang mag-alala" iyon lang ang sagot ng dalaga sa kanya

21. But the point is that research in the field of the development of new energy sources must be carried on further and expedited so that the exhaustion of conventional sources of power does not adversely affect the growth of our economy and the progress of civilization

22. Hindi ko maintindihan kung ano ang nangyari kaya ako ay tulala sa kawalan.

23. Kapag nagluluto si Nanay, ang buong bahay ay napupuno ng mabangong amoy ng pagkain.

24. At blive kvinde handler også om at lære at håndtere livets udfordringer og modgang.

25. They offer rewards and cashback programs for using their credit card.

26. Leukemia is a type of cancer that affects the blood and bone marrow.

27. Kebahagiaan juga dapat ditemukan dalam pengembangan diri, seperti belajar hal baru atau mengejar hobi yang disukai.

28. Kasama ng kanilang mga kapatid, naghihinagpis silang lahat sa pagkawala ng kanilang magulang.

29. Sa mga panahong gusto kong mag-reflect, pinapakinggan ko ang mga kanta ng Bukas Palad.

30. 11pm na. Pinatay ko na ilaw sa hospital room ni Cross.

31. The telephone has undergone many changes and improvements since its invention, and it continues to evolve with the rise of mobile phones

32. Maglalakad ako papuntang opisina.

33. Christmas is an annual holiday celebrated on December 25th to commemorate the birth of Jesus Christ.

34. Kinuskos niya ang kanyang buhok at nabasa pati ang kanyang anit.

35. From there it spread to different other countries of the world

36. Kung napaaga ng tatlumpung segundo sana ang dating niya ay naabutan pa sana niya ang karwaheng sinasakyan nina Helena.

37. Gusto kong maging maligaya ka.

38. Mahabang pangungusap ang isinulat ni Lito sa pisara.

39. Dali-daling umalis ang binata patungo sa palasyo.

40. Rutherford B. Hayes, the nineteenth president of the United States, served from 1877 to 1881 and oversaw the end of Reconstruction.

41. Ang pag-asa ay nagbibigay ng pag-asa sa mga taong nakakaranas ng mga krisis at mga suliranin sa buhay.

42. Es importante cosechar las zanahorias antes de que se pongan demasiado grandes.

43. Ngunit lumakas ang agos ng ilog, at napailalim sa tubig ang mag-aama.

44. Ang paggamit ng mga apps at gadgets bago matulog ay maaaring makaapekto sa kalidad ng tulog ng isang tao.

45. Mommy. ani Maico habang humihingal pa.

46. Nakatayo ang lalaking nakapayong.

47. Tumugtog si Jemi ng piyano kahapon.

48. Sa ganang iyo, mas epektibo ba ang online classes kaysa sa face-to-face na pagtuturo?

49. Mahalagang igalang ang kalayaan ng ibang tao sa pagpapasiya ng kanilang mga sariling buhay.

50. Napakalamig sa Tagaytay.

Recent Searches

sonidonaglabanandefinitivowasakmalikotfulfillingaminlivespaskongbeganbototiniohitiksemillasgoshdiagnosestwitchletterblazinghuwebessumagotkagandamaulitpinamalagitutubuinbatokestarpartynyagearsamfundgabingnooipinadalabusiness,hidingnasabingbarrocopag-uugalibipolarmalinisriskipinabalikdinalawmulighedlimosroonwidespreadfreelancersparksumindimagpuntanakitamataaskiloibabaplaysaudithitbumabapromotingcebunaritocuentanmillionscongratsdinibakesofamagbubungainfluencebadpinilingspeechtiposnasundonaroonferrerfurtherresponsibleginawapangalanwindoweffectexistformsexplainmediumelectedfroginteractnamungaactivityfacultygotbrainlyipagpalitobservererpalaytumatawakinagagalakkailanmannag-replynagreplynagkikitamalapadkasomartialdoesjuniomatulunginanikondisyondosmesanaiinitanlumipadwowdogsperaasomaipagmamalakingmagbantaynakatawagkalalakihanlasaikinabubuhaysakyanlalopagpapatuboinilistastatesappfamilytigasgeneratehelptinymauupopinaghalopinakamagalingganapinspindlebasketballnandiyanlegacynagmamadalibumabahacirclecommunicatesurgerylayasgabi-gabingunitmarunonginomnerobulonggratificante,nakapapasongngingisi-ngisingkinakitaanlikesbuung-buomahawaannakatirarevolutioneretmakatarungangmeriendamagagandangikinalulungkothitsuramakitanagpalalimtinatawagsasakaynandayalumakaskumakainmagbalikpagpanhikkalalaroinvesting:panalanginnaguguluhanpangangatawannakabawidiscipliner,isusuotmasaktanpagbigyanbuwenasnearkommunikererhouseholdkaklaseumagawhinihintaybyggetsukatin