Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

4 sentences found for "sonido"

1. El primer llanto del bebé es un hermoso sonido que indica vida y salud.

2. El teléfono es un dispositivo electrónico que permite la comunicación a distancia mediante el uso de señales de sonido

3. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

4. En resumen, el teléfono es un dispositivo electrónico que permite la comunicación a distancia mediante el uso de señales de sonido

Random Sentences

1. Nagdiretso ako sa kusina at binuksan ang ref.

2. When I saw that Jake and his friends all had tattoos and piercings, I thought they might be a rough crowd - birds of the same feather flock together, right?

3. He has been practicing basketball for hours.

4. Sa droga, hindi ka lamang nanganganib sa iyong kalusugan, kundi pati na rin sa iyong kaligtasan.

5. Ilang tao ang pumunta sa libing?

6. The introduction of the dial telephone in the 1920s further improved the telephone system, as it allowed for faster and more efficient call connections

7. Additionally, the use of automation and artificial intelligence has raised concerns about job displacement and the potential for these technologies to be misused

8. Seek feedback, it will help you to improve your manuscript

9. Malamig sa Estados Unidos kung taglagas.

10. Remember that the most important thing is to get your ideas and message out to the world

11. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

12. Kung kaagaw ko ang lahat, may pag-asa bang makilala ka?

13. Pwede bang sumigaw?

14. Ang aming angkan ay mayroong natatanging uri ng pagluluto.

15. The use of emphasis is influenced by cultural and social norms.

16. Ailments can be caused by various factors, such as genetics, environmental factors, lifestyle choices, and infections.

17. Ngunit may isang hayop ang hindi niya malaman kung saan siya papanig.

18. Sila ay nagsisilbing modelo ng katapangan, katapatan, at pagmamahal sa bayan.

19. Maasim ba o matamis ang mangga?

20. Si Tom ay nag-aapuhap ng paumanhin sa kanyang mga kaibigan matapos ang kanilang pag-aaway.

21. Instagram Stories is a feature that lets users share temporary photos and videos that disappear after 24 hours.

22. Mayroon pa ba kayong gustong sabihin?

23. Marunong nang maglinis at magtago ang mga taong marurumi.

24.

25. The first dance between the bride and groom is a traditional part of the wedding reception.

26. Hiram na libro ang ginamit ko para sa aking research paper.

27. Kebahagiaan adalah keadaan emosional yang diinginkan oleh setiap orang.

28. We finished the project on time by cutting corners, but it wasn't our best work.

29. El agricultor utiliza técnicas de riego para asegurar el crecimiento óptimo de sus cultivos.

30. La realidad nos enseña lecciones importantes.

31. Mi amigo y yo nos conocimos en el trabajo y ahora somos inseparables.

32. Napangiti siyang muli.

33. Naging masaya ang aking buhay dahil sa aking mga kaulayaw.

34. My favorite thing about birthdays is blowing out the candles.

35. Ang pagtutulungan ng mga lokal na pamahalaan at mga grupo sa komunidad ay mahalaga sa pagtugon sa problema ng paggamit ng droga.

36. Mas pinapaboran ko ang pulotgata kaysa sa kendi kapag gusto ko ng matamis na panghimagas.

37. Ano ang pinapanood mo sa telebisyon?

38. May sisenta sentimos nang kumakalansing sa bulsa ng kutod niyang maong.

39. Los días soleados de invierno pueden ser fríos pero hermosos, con un cielo azul brillante.

40. Ang mga bata ay lumabas ng paaralan nang limahan.

41. Los niños de familias pobres a menudo no tienen acceso a una nutrición adecuada.

42. Sometimes it is necessary to let go of unrealistic expectations or goals in order to alleviate frustration.

43. Puwede ka ring magguhit ng mga larawan ng kalikasan upang magpakita ng pagmamahal sa ating planeta.

44. He is also remembered for his generosity and philanthropy, as he was known for his charitable donations and support of various causes

45. You need to pull yourself together and face the reality of the situation.

46. Make use of writing software and tools, they can help you to organize your thoughts and improve your writing

47. Medarbejdere kan arbejde i forskellige miljøer som kontorer eller fabrikker.

48. Sa kaibuturan ng kanyang damdamin, mahal niya ang kanyang mga kaibigan.

49. Nagtataka ako kung bakit hindi mo na ako tinutulungan tulad ng dati.

50. Mag-iikasiyam na nang dumating siya sa pamilihan.

Recent Searches

parinibinalitangdisposalsonidopuwedemalikotpasensyajocelyncharismaticnakabinatakisiporderinreplacedtapattinderagivemahahababaroaabotvalleypangitnunosinumanglarolalarealisticmangeviolencevelstandlikessignmeansgandajokeparagraphspakainhigitilogabalaterminobalingsubalitsinapakloansbabaememorialperlaprobablementefeelnilinismisamaitimredeswalistodomamidevelopedcebusamululusograilrosepakpakcigarettesdedication,bringcleanipapahingaconsiderardaratingturonobstaclesnutrientesauditdaddymapadalibumugaonlyfeedbackelectedpotentialannamonetizingstateevenlimitbringingdostableformscomputerdependingeditwindowelectalas-diyesincreasesquicklytermsetsnakatunghaypagdatingtabing-dagatgiverbasahinika-12totoopahirapansalontaokatabingmatagalkamaylasingeroprimerosrosamalumbaycoaching:magkasinggandaranayoffentligeksamtiposcakeschoolpromotingideacigaretteauthoralinpdasisidlanpinagjuanpangkatsalbahebundoksinakopathenaasiapromotedustpansundhedspleje,gayunpamanmakikitagabi-gabimagkasintahanpagpapakilalamagta-trabahonakapagngangalitunibersidadmakapagsabihumahangoshinipan-hipannapakahusayeskwelahanpagkakamalipamanhikanpinagalitannyomahiyaencuestashoneymoonyoutube,naiilaganmakatuloghimihiyawnakauwimedicinetravelmakikiligopinagbigyanpagkatakotnag-aagawansasamahaninvesting:crucialpagtawapagdukwangnagawangnaghuhumindignakikiahonestokulturjosiegiyerabumaligtadbasketbolnanangismahabangnaiiritangnahahalinhannaghilamosbalitabatamanahimikpinangalanangpumayagestasyon