Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

4 sentences found for "sonido"

1. El primer llanto del bebé es un hermoso sonido que indica vida y salud.

2. El teléfono es un dispositivo electrónico que permite la comunicación a distancia mediante el uso de señales de sonido

3. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

4. En resumen, el teléfono es un dispositivo electrónico que permite la comunicación a distancia mediante el uso de señales de sonido

Random Sentences

1. It has revolutionized the way we communicate and has played a crucial role in shaping modern society

2. She attended a series of seminars on leadership and management.

3. Kaya kahit nang dalhin ko siya sa isang karnabal, isa lamang ang ninais niyang sakyan.

4. Sa panahon ng pandemya, mas marami ang nangangailangan ng bukas palad na pagtulong mula sa atin.

5. Naglalaro ang walong bata sa kalye.

6. Hindi niya naiilagan ang dagok ni Ogor.

7. Taga-Ochando, New Washington ako.

8. Lazada's influence on the e-commerce industry in Southeast Asia is significant, and it is likely to continue to be a major player in the years to come.

9. Las vacaciones son una oportunidad perfecta para desconectar del trabajo.

10. Advanced oscilloscopes offer mathematical functions, waveform analysis, and FFT (Fast Fourier Transform) capabilities.

11. Modern civilization is based upon the use of machines

12. Gusto ko ang mga bahaging puno ng aksiyon.

13. Paano po pumunta sa Greenhills branch?

14. The use of computers and the internet has greatly improved access to information and resources, and has made it possible for people to learn at their own pace and in their own way

15. Dahil sa determinasyon sa pag-aaral, si James ay naging valedictorian ng kanilang eskwelahan.

16. Ano namang inasikaso mo sa probinsya?

17. Ang taong may takot sa Diyos, ay hindi natatakot sa mga tao.

18. Nagpunta ako sa may kusina para hanapin siya.

19. She admired the way her grandmother handled difficult situations with grace.

20. En mi tiempo libre, aprendo idiomas como pasatiempo y me encanta explorar nuevas culturas.

21. Hindi matanggap na malisan sa kanyang iniibig ay mahigpit nyang hinawakan ang kamay ng prinsipe.

22. Kobe Bryant was known for his incredible scoring ability and fierce competitiveness.

23. Magandang-maganda ang pelikula.

24. Les personnes âgées peuvent avoir des difficultés à se déplacer ou à effectuer des tâches quotidiennes.

25. Vivir en armonía con nuestra conciencia nos permite tener relaciones más saludables con los demás.

26. Dumaan ka kay Taba mamayang pag-uwi mo, narinig niyang bilin ng ina.

27. The construction of the building required a hefty investment, but it was worth it in the end.

28. Mabibingi ka sa ingay ng kulog.

29. I complimented the pretty lady on her dress and she smiled at me.

30. Some people choose to limit their consumption of sweet foods and drinks for health reasons.

31. Bukas ang biyahe ko papuntang Manila.

32. Ang bayanihan ay nagpapalakas ng samahan at pagkakaisa sa aming pamayanan.

33. Los héroes son capaces de tomar decisiones difíciles y hacer sacrificios personales en beneficio de los demás.

34. Muchas empresas utilizan números de teléfono de línea directa o números de call center para brindar soporte técnico o atención al cliente

35. Sumakay ka sa harap ng Faculty Center.

36. Ngumiti siya ng malapad sabay hagikgik.

37. Mahilig sya magtanim ng mga halaman sa kanilang lugar.

38. Les travailleurs doivent respecter les heures de travail et les échéances.

39. La creatividad nos permite pensar fuera de lo común y encontrar soluciones creativas a los desafíos que enfrentamos.

40. Nagitla ako nang biglang may lumabas na ahas mula sa mga halamanan.

41. Bawal magpakalat ng mga hate speech dahil ito ay nakakasira ng kalagayan ng mga taong napapalooban nito.

42. Ipinagbabawal ang marahas na pag-uusap o pagkilos sa paaralan.

43. Many countries around the world have their own professional basketball leagues, as well as amateur leagues for players of all ages.

44. Many people experience stress or burnout from overworking or job dissatisfaction.

45. Setelah kelahiran, bayi akan dianggap sebagai anggota baru dalam keluarga dan masyarakat.

46. El cultivo de café requiere de un clima cálido y suelos fértiles.

47. Mi aspiración es ayudar a los demás en mi carrera como médico. (My aspiration is to help others in my career as a doctor.)

48. Wag mong ibaba ang iyong facemask.

49. Hindi umimik si Aling Marta habang minamasdan ang bata.

50. Ang mga NGO ay nag-aapuhap ng donasyon upang matulungan ang mga batang ulila.

Recent Searches

sonidomagkasinggandadisposalilawkaarawantodoxixnag-away-awaypalapitdipangscottishinomsigamasdangamotparang1973adverseyepmaestrobarrocoeffektivcellphonegeneresortsabaymapuputicryptocurrency:importantesbataymedievaldiamondmanuscriptterminopinatidrailwaysouevideopageguardapicsoliviaabihigitmisusedbumugalinephysicalmalaboearlydaanumiinitflexiblecebusiguroitsibababulsaipinagbilingsurgerypressneroputahejamesmedicineorasboylikelycrossyonbeingstuffedeksamhalikafacilitatingnagkaroonnapilingeffectsalapisetsnegativeguiltysteerprovidedmaputipetsanagbibiroyumabongkumirotkapangyarihanlumalakitandangsalaminnamuhayumiibigkinakainmantikaiyamotpaggitgitpanunuksoeksport,pinaulanandailymasayangsasapakinflamenconanoodpampagandasandalingmariehinintaypakealamnoonhelpedmegetbiyayangkatabingtonightbinulongcasaipagamotsubjectfridayideasunderholdermatindinginformedendvidereeskwelahantumaggapmakasarilingsumugodelectionsbluelegislativeshowlorimagitingshouldpackagingdoonmakilingnananaginippagkakayakapdugonagngangalangnagtatakbonagtuturosustentadonagtrabahonakumbinsitinatawaghumiwalayentrancenawalangminu-minutopagkapasokbayawakbusinesseshandaannakakatandafitnesspinakidalapalancadaramdaminumakbaydisfrutarmensahehayaanpresidentekabutihanmaintindihanmagpapakabaitskyldes,apatnapumagturoopobuwenaskommunikerershapingintramuroskontinentengsagutindiyanmarketing:tumamakagubatanevolucionadonatalomensika-50makilalaumangatmahabolmagawalagnatuniversitiesbinasanuevosmaluwag