Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

4 sentences found for "sonido"

1. El primer llanto del bebé es un hermoso sonido que indica vida y salud.

2. El teléfono es un dispositivo electrónico que permite la comunicación a distancia mediante el uso de señales de sonido

3. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

4. En resumen, el teléfono es un dispositivo electrónico que permite la comunicación a distancia mediante el uso de señales de sonido

Random Sentences

1. Tesla was founded by Elon Musk, JB Straubel, Martin Eberhard, Marc Tarpenning, and Ian Wright.

2. Sa tulong ng mga batang nagsilapit, ang matanda ay nakatindig.

3. At naroon na naman marahil si Ogor.

4. El estudio de la música ayuda a las personas a desarrollar habilidades importantes, como la creatividad, la concentración y la capacidad de trabajar en equipo

5. Pumasok ako sa cubicle. Gusto ko muna magisip.

6. Si Maria ay na-suway sa utos ng guro na tapusin ang kanyang takdang gawain.

7. Mens nogle mennesker nyder gambling som en hobby eller en form for underholdning, kan det også føre til afhængighed og økonomiske problemer.

8. La labradora de mi amigo es muy valiente y no le teme a nada.

9. Women have been instrumental in driving economic growth and development through entrepreneurship and innovation.

10. Bawal kumain sa loob ng silid-aralan upang mapanatili ang kalinisan ng paaralan.

11. I forgot my phone at home and then it started raining. That just added insult to injury.

12. Elektronisk udstyr kan hjælpe med at reducere energiforbrug og spare penge.

13. Emphasis can help clarify and reinforce the meaning of a message.

14. He might be dressed in casual clothes, but you can't judge a book by its cover - he's a successful business owner.

15. Sobrang mahal ng cellphone ni Joseph.

16. Scientific evidence has revealed the harmful effects of smoking on health.

17. Sumang ayon naman sya sa mungkahi ng kanyang kasintahan.

18. Ang panaghoy ng kalikasan ay naririnig sa bawat pagkalbo ng kagubatan.

19. Anong oras nagbabasa si Katie?

20. La amistad entre ellos se fortaleció después de pasar por una experiencia difícil.

21. Sueño con tener un estilo de vida saludable y activo. (I dream of having a healthy and active lifestyle.)

22. The child was too young to receive the pneumonia vaccine and needed to be protected from exposure.

23. Nabagalan ako sa simula ng pelikula.

24. Ano namang inasikaso mo sa probinsya?

25. La paciencia es la clave para conseguir lo que deseamos.

26. En algunos países, el Día de San Valentín se celebra como el Día del Amigo.

27. Gusto ko nang kumain, datapwat wala pa akong pera.

28. Pakibigay ng respeto sa mga matatanda dahil sila ang unang nagtaguyod ng ating komunidad.

29. Hinugot niya ang kanyang hininga bago siya sumagot sa tanong ng guro.

30. Today, Bruce Lee's legacy continues to be felt around the world

31. The executive branch, represented by the President of the United States, is responsible for enforcing laws

32. Stocks and bonds are generally more liquid than real estate or other alternative investments.

33. Nagalit ang matanda at pinalayas ang babaeng madungis.

34. Naulinigan ng makapangyarihang Ada himutok ng Buto.

35. They admire the way their boss manages the company with fairness and efficiency.

36. The city's vibrant nightlife offers a variety of entertainment options, including nightclubs, bars, and live music venues.

37. I rarely take a day off work, but once in a blue moon, I'll take a mental health day to recharge my batteries.

38. La realidad a veces es cruel, pero debemos enfrentarla con valentía.

39. Einstein was born in Ulm, Germany in 1879 and later emigrated to the United States during World War II.

40. Les entreprises cherchent souvent à maximiser leurs profits.

41. Natatanaw na niya ngayon ang gripo.

42. Hindi naman yan iniisip eh! Pinapakiramdaman!

43. Walang 'tayo' Maico. Kaya please lang iwan mo na ako.

44. Hindi mapigil ang pagkakatitig niya sa pagkain na naglalaway na sa harap niya.

45. Think about what message you want to convey, who your target audience is, and what makes your book unique

46. At blive kvinde handler også om at lære at tage vare på sig selv både fysisk og mentalt.

47. Tesla has a strong and passionate community of supporters and customers, known as "Tesla enthusiasts" or "Teslaites."

48. Dedication is the driving force behind artists who spend countless hours honing their craft.

49. Sa loob ng ilang taon, yumabong ang industriya ng teknolohiya sa bansa.

50. There's no place like home.

Recent Searches

sonidooutlineaffiliatelipadpuwedeanihinbateryanakahigangnanahimikpagsumamonakapapasongpinakamatabangnakatunghaynalulungkotkaibiganpusangcultivopinagkaloobannamumukod-tangisenatehitapinasalamatanaktibistasasagutinentrancekonsultasyonguerreronatitiyakkarapatanganumangmatumaldali-dalingnaglutopwestocandidatelunesgabidisenyopatientkakayanangngipingpakaininmakisuyomakakaitinaobpigilanmaskinerjeepneysusunodsalitangbestidanoongupuanparehasmonumentoracial1787gabingdietsentencetinderahugisseniorpagsasalitanatanggapaywanpiecesdiamondespigasburmamaluwangbilhintodayseekleukemiabroadcastbensellahitvasquesdumatingprofessionalfanssoontherapyperlasteeractorendviewsaideyehalikabiyasprogramamaptutorialsbatavisualguidewritesummithimigshipbestfriendjemipangiltilanamatayunahinheynakakainkalabawlalakadpambatangnanlalamigmaipagmamalakingpinamalagikanikanilangginagawatelecomunicacionesmakaiponipinauutangtinungomagkanofactoresmagdamagnagbabasaothersmatayogsinaexpeditedtayoenglandnapadaanyamanlittlekinatatayuantabassabadongnagpabayadnakumbinsiespecializadasnagtagisanpagpasensyahannagsisipag-uwiangayundinkaninohanapbuhaypeksmanbalediktoryanngumingisiapatnapumagturohayaangflyvemaskinerinvesting:nakadapadumagundongnakuhangmakapagsabipaglalabadamatapobrengnakakapamasyalmakasamakinahuhumalinganalanganmatandangumokayasukalgagamitemocionesnaantiglever,iniresetalalimbayaningunosbiyernespagsidlannapadpadmagtanimnagwikangiconseducationpangalanuntimelydefinitivomatarayimagessagapinakyatpagputisusinatulogahasninyomatipunoantokstreet