Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

4 sentences found for "sonido"

1. El primer llanto del bebé es un hermoso sonido que indica vida y salud.

2. El teléfono es un dispositivo electrónico que permite la comunicación a distancia mediante el uso de señales de sonido

3. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

4. En resumen, el teléfono es un dispositivo electrónico que permite la comunicación a distancia mediante el uso de señales de sonido

Random Sentences

1.

2. Human trafficking is a grave crime that needs immediate action worldwide.

3. Naranasan ko na ang agaw-buhay na pakikipaglaban para sa aking mga pangarap.

4. Motion er en vigtig del af en sund livsstil og kan have en række positive sundhedsmæssige fordele.

5. The telephone has undergone many changes and improvements since its invention, and it continues to evolve with the rise of mobile phones

6. This can include creating a website or social media presence, reaching out to book reviewers and bloggers, and participating in book signings and events

7. Nakakuha ako ng sagot sa brainly.

8. Nanlilimos ang magandang babae ng makakain.

9. Medarbejdere kan skifte karriere når som helst i deres liv.

10. Isa lang ang bintana sa banyo namin.

11. Nangahas ang binata na sumagot ng pabalang sa kanyang ama.

12. Sa aking probinsya, tawag sa pulotgata ay "latik".

13. Bilang paglilinaw, hindi ako nagsabi na aalis ako, kundi lilipat lang ako ng departamento.

14. Sa aming barangay, nagkaroon ng malawakang paglilinis ng kanal dahil sa bayanihan ng mga residente.

15. Tak kenal maka tak sayang.

16. TV can be used for educating the masses, for bringing to us the latest pieces of information audio-visually and can provide us with all kinds of entertainment even in colour.

17. Ito ang tanging paraan para mayakap ka

18. Les échanges commerciaux peuvent avoir un impact sur les taux de change.

19. ¿Me puedes explicar esto?

20. Ang sabi naman ni Bereti ay naiinggit kay Karing dahil marami itong bagay na nararanasan na hindi niya nararanasan.

21. Mangiyak-ngiyak siya.

22. Ang awitin ng makata ay puno ng hinagpis na naglalarawan ng kanyang pagkabigo sa pag-ibig.

23. Arbejdsgivere kan bruge fleksible arbejdsmetoder for at hjælpe medarbejdere med at balancere deres arbejds- og privatliv.

24. Labis kang nasugatan, mabuti pa siguro ay sumama ka sa akin upang magamot ng aking asawa ang iyong mga sugat.

25. Dedicated teachers inspire and empower their students to reach their full potential.

26. They are attending a meeting.

27. Eksport af teknologi er en stigende del af den danske eksport.

28. La paciencia nos ayuda a controlar nuestras emociones.

29. Ano ho ang ginawa ng mga babae?

30. Kahit malayo ka, hindi nawawala ang pagkagusto ko sa iyo. Crush kita pa rin.

31. Sa gitna ng pagluluto, nagitla ako nang biglang mag-expire ang gasera.

32. But recently it has been detected that the habit of smoking causes different kinds of serious physical ailments, beginning with coughing, sore throat, laryngitis, and asthma, and ending with such a fatal disease as cancer

33. Bilang paglilinaw, ang sinabi kong oras ng meeting ay alas-dos ng hapon, hindi alas-tres.

34. If you want to secure a good seat at the concert, you have to arrive early - the early bird gets the worm.

35. Mommy. ani Maico habang humihingal pa.

36. The novel might not have an appealing cover, but you can't judge a book by its cover - it could be a great read.

37. Ang mailap na pagkakataon ay kailangan hanapin sa kung saan-saan upang hindi ito masayang.

38. Han blev forelsket ved første øjekast. (He fell in love at first sight.)

39. Når man bliver kvinde, er det vigtigt at have en sund livsstil og pleje sit helbred.

40. Espero que te recuperes pronto, cuídate mucho y sigue las indicaciones del médico.

41. Successful entrepreneurs attribute their achievements to hard work, passion, and unwavering dedication.

42. Paano ho ako pupunta sa Palma Hall?

43. Hindi ko matiis ang pagkaantabay sa kanyang mga mensahe dahil gustung-gusto ko siyang kausapin.

44. Nagpatawag ng pagpupulong ang guro sa silid-aralan upang pag-usapan ang mga plano para sa darating na taon.

45. Facebook Events feature allows users to create, share, and RSVP to events.

46. They are not building a sandcastle on the beach this summer.

47. I am not exercising at the gym today.

48. The acquired assets will help us expand our market share.

49. Pagkatapos ng isang daang metro kumanan ka.

50. Las bebidas calientes, como el chocolate caliente o el café, son reconfortantes en el invierno.

Recent Searches

imagesklasengmeronmaibalikpasigawsonidoalasstocksmaidshinesnatulogsitawbumuhoseconomydaanataunopostershapingthroughoutinuminfinisheddrewdragonngpuntaoperatedeleeveninggamepalagingguestsitinalilarrynathanbalelegislativedeveloped18thsumakitanimoabenenagtatampokanilaulingnapilingtypessalapireadmessageemphasizedmapwhilewritereallybitbitflashcontrolledrefmediumayanmitigatecomunicarseipinalutoimpactedscaleanothercableclassmateshouldawareniceviewmonumentolarawanuminommakuhanggoodeveningnakauponagtitiisnagkitanakapamintananagpapaniwalagayundinvirksomheder,napakahanganakakunot-noongpagsasalitakanya-kanyangagwadormagkikitabaku-bakongmakalaglag-pantypinakamahalagangkayang-kayangnakatapatpagtangisnagreklamonagpakunotmarketplacesuusapanbinibiyayaancultivaunti-untipamamasyalpaglalaitmamanhikanpinahalatanakikilalangfilmnakatayomagkaparehonagsasagotmakitamoviesnagpakitatinulak-tulakhumalakhaknalulungkotiniligtaskasingtigasnakabiladtusongreachsisentakalikasannearutilizanbayaningitinaastitapauwiakinmabangisnatigilanpakilagayneedmakikitulogngumiwimaisusuothandaanmahiyadisfrutarpaki-ulitninanaispandidiripaglalabamasaksihanpioneeruugod-ugodnapakalusoghayaanarbejdsstyrkehouseholdssulyapbulaklakmakakakaenkatuwaanmovieleksiyonpinasalamatannapagtantotinutopbinge-watchingnapililumindolgawaingmagbabalanagyayangindustriyahigantenasaangcanteengumigisingpagbebentakakilalaapelyidoika-12paulit-ulittutusintutungosundhedspleje,countrysenadorpabulongberegningerpinauwimagandangtrabahomakakabalikpumayagnilolokonagsimulanaglulusakpromiseunconstitutionalinspirationbumalikpagbatinabigaymusic