Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

4 sentences found for "sonido"

1. El primer llanto del bebé es un hermoso sonido que indica vida y salud.

2. El teléfono es un dispositivo electrónico que permite la comunicación a distancia mediante el uso de señales de sonido

3. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

4. En resumen, el teléfono es un dispositivo electrónico que permite la comunicación a distancia mediante el uso de señales de sonido

Random Sentences

1. La esperanza es un regalo que debemos valorar y compartir con los demás. (Hope is a gift that we should cherish and share with others.)

2. The team's colors are purple and gold, and they play their home games at the Staples Center.

3. Tesla's Powerwall is a home battery system that allows homeowners to store energy for use during peak hours or power outages.

4. Ang panaghoy ng mga pasyente ay naging panawagan para sa mas maayos na serbisyong pangkalusugan.

5.

6.

7. Baby fever can be accompanied by increased attention to one's physical health and well-being, as individuals may want to ensure the best conditions for conception and pregnancy.

8. Sa pagguhit, mahalaga ang pagpili ng tamang kasangkapan tulad ng lapis, papel, at krayola.

9. Hindi mo sadyang nakuha ang isang mataas na marka sa pagsusulit.

10. La literatura japonesa tiene una sutileza sublime que trasciende las barreras culturales.

11. Paano ako pupunta sa airport?

12. En invierno, los árboles pierden sus hojas y se vuelven caducos.

13. A lot of birds were chirping in the trees, signaling the start of spring.

14. Ang agam-agam ay maaaring maging hadlang sa pagpapasiya at pagkilos ng tao.

15. Napakalungkot ng balitang iyan.

16. Rapunzel is a girl with long, magical hair who is locked in a tower until a prince comes to her rescue.

17. There are a lot of books on the shelf that I want to read.

18. Kumusta ang nilagang baka mo?

19. Para sa malilimutin, malaking tulong ang paggamit ng alarm sa cellphone.

20. Kinakailangan niyang kumilos, umisip ng paraan.

21. Ilan ang computer sa bahay mo?

22. Mathematics is a language used to describe and solve complex problems.

23. Los árboles pueden perder sus hojas en invierno, creando un aspecto desnudo y frío.

24. La esperanza y los sueños son una parte importante de la vida. (Hope and dreams are an important part of life.)

25. Ang mga matatamis na melodiya ng kundiman ay nakakapukaw ng damdaming umiibig.

26. Gusto. pag-amin ko kasi gutom na gutom na talaga ako.

27. Amazon has a vast customer base, with millions of customers worldwide.

28. The feeling of falling in love can be euphoric and overwhelming.

29. Nauntog si Jerome sa kanilang pintuan.

30. Electric cars, also known as electric vehicles (EVs), use electricity as their primary source of power instead of gasoline.

31. He practices yoga for relaxation.

32. He does not waste food.

33. I don't usually go to the movies, but once in a blue moon, there's a film that I just have to see on the big screen.

34. Sa digmaan, ang militar ang pinakamahalagang sangay ng pamahalaan.

35. Gaano karami ang dala mong mangga?

36. Ilang oras silang nagmartsa?

37. Ano ang gustong bilhin ni Juan?

38. Mawala ka sa 'king piling.

39. We need to calm down and not let this become a storm in a teacup.

40. Hindi ko mapigilan ang puso ko na tumibok kapag nakikita kita. Crush kita talaga.

41. Ang mga bayani ay nagpapakita ng disiplina at determinasyon sa paglutas ng mga problema ng bayan.

42. Mga bopols! Tape lang hindi nyo pa nagawang makabili!

43. Women have been leaders in social justice movements, such as the civil rights movement and the women's suffrage movement.

44. Nationalism can have a positive impact on social and economic development.

45. Nasa labas ka ba? Teka puntahan kita dyan.

46. When we forgive, we break the cycle of resentment and anger, creating space for love, compassion, and personal growth.

47. Hindi ko mapigilan ang aking mga titig sa aking nililigawan dahil sobrang ganda niya.

48. La comida tailandesa es famosa por su sabor picante.

49. Amazon is an American multinational technology company.

50. Ang mga pangarap natin ay nagtutulak sa atin upang magkaroon ng mga positibong pagbabago sa buhay.

Recent Searches

panindangaffiliatebalangangkanboholpaskongsonidolimitedstruggledmalikotsoundmaidpigingvivapagputipagka-maktolformasmapuputicebuhumanosamonglaylaygranlabanklimalargerzoompropensodalawgreatpsh1980dinalawawitbadinginteriorcomputeresamabringimproveseencouldcontinuesidea:ipapainitimagingabspersonsislakartonconvertidaswikatumubongnamnaminkitatilanagtitindaworkshopprogramasystemyeahbehaviorandroidrepresentedflashoftentypesaffectmuchcreationscaleviewhardinjannagmistulangkatagangyourself,sagotsumingitmayikinagalitnagwikanggainmagpagkuwasumpanasabieksport,humpaymarilougripohastaarguekuwentomedyopwedeitshotelfe-facebookchickenpoxmatitigaskuwebabundokhanginpinatirao-orderapologeticpa-dayagonalmakulitbandakasamapaldamatipunobotomaarihehesalatillpalapit192900amanitosentencebingoscottishnagdarasalpumatolfauxpepeantokparanuoncommissionbaulsoresakinlegendsbobosumabogmabilisbernardotuwangaywan1000fiaresignationmaghilamospalakolgraduallybathalawouldimpactedactiondigitalfullhimiginternetbinababeginningnasundotruepracticadolayunincesdaratingclientsdiliginhiligmangkukulampinagmamasdanpamilihanrebolusyonpaki-drawingteknologihiwanakikiakare-kareentrancenakatapatkahaponsobrapronounpaghihingalopagkapasoksinabinagkapilateskuwelaiba-ibangnagnakawkatawangnalalabialas-diyesnahawakanpapagalitanhitsuranagwelganakumbinsitinaasanmeriendanakatuwaang