Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

2 sentences found for "shopee"

1. Ang mumura ng bilihin sa Shopee.

2. Bumili ako ng sapatos sa Shopee.

Random Sentences

1. Los motores de búsqueda nos permiten encontrar información específica en línea.

2. A picture is worth 1000 words

3. The genetic material allows the virus to reproduce inside host cells and take over their machinery.

4. Omelettes are a popular choice for those following a low-carb or high-protein diet.

5. Kapag may tiyaga, may nilaga.

6. Naglalaba ako ng mga sapatos pagkatapos ng malakas na pag-ulan para hindi ito maaksididente.

7. Hinde no. Baka kasi pag tumaba ako ipagpalit mo ko bigla eh!

8. Nakita niya ang isang magandang babae sa kaniyang harapan.

9. Miguel Ángel murió en Roma en 1564 a la edad de 88 años.

10. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

11. Vivir en armonía con nuestra conciencia nos permite tener relaciones más saludables con los demás.

12. Limiting alcohol and caffeine intake can improve overall health.

13. I heard that the restaurant has bad service, but I'll take it with a grain of salt until I try it myself.

14. Some individuals may choose to address their baby fever by actively trying to conceive, while others may explore alternative paths to parenthood, such as adoption or fostering.

15. En invierno, las personas disfrutan de bebidas calientes como el chocolate caliente y el té.

16. Ang kalayaan ay nagbibigay ng inspirasyon at lakas ng loob sa bawat isa upang ipaglaban ang kanilang mga pangarap at layunin.

17. Nakapagreklamo na ako sa pakete ko.

18. The DNA evidence led to the arrest of the culprit in the murder case.

19. Taman Safari Indonesia di Bogor adalah tempat wisata yang menampilkan satwa liar dari berbagai belahan dunia.

20. Lasingero ang tawag sa taong laging nag-iinom ng alak.

21. Ang pusa ay nasa ilalim ng upuan.

22. The garden boasts a variety of flowers, including roses and lilies.

23. Busog pa ako, kakatapos ko lang mag merienda.

24. Grande married Dalton Gomez, a real estate agent, in May 2021 in a private ceremony.

25. The invention of the telephone led to the creation of the first radio dramas and comedies

26. Millard Fillmore, the thirteenth president of the United States, served from 1850 to 1853 and signed the Compromise of 1850, which helped to delay the outbreak of the Civil War.

27. Magkano ang pasahe sa bus mula sa Quezon City

28. Hindi dapat nakatutok tayo sa mga kababawan ng buhay, kundi sa kabutihan ng ating kapwa at ng ating bansa.

29. Huminga ka ng malalim at tayo'y lalarga na.

30. Ipinagtanggol ng mga obispo ang doktrina ng purgatoryo sa kanyang homiliya.

31. Some limitations can be temporary, while others may be permanent.

32. Kobe Bryant was known for his incredible scoring ability and fierce competitiveness.

33. Matutulog ako mamayang alas-dose.

34. Los alimentos ricos en calcio, como los productos lácteos y el tofu, son importantes para la salud ósea.

35. Nasa akin pa rin ang huling halakhak.

36. Nag smile siya sa akin, at nag smile rin ako sa kanya.

37. Tulala siyang tumitig sa malawak na tanawin ng dagat.

38. Dumating ang mga atleta sa entablado nang limahan.

39. La escultura de Leonardo da Vinci nunca fue tan famosa como su pintura.

40. Basketball players are known for their athletic abilities and physical prowess, as well as their teamwork and sportsmanship.

41. A couple of lovebirds were seen walking hand-in-hand in the park.

42. Ang pagsasawalang-bahala sa mga mensahe ng katotohanan ay nagpapakita ng pagiging bulag sa katotohanan.

43. Winning the championship left the team feeling euphoric.

44. Naglaro sa palaruan ang mga bata nang limahan.

45. Wag ka nang malumbay dahil nandito naman ako.

46. Sa dapit-hapon, masarap tumambay sa beach at mag-enjoy sa tubig.

47. Umalis siya kamakalawa ng umaga.

48. Ang mahagway na katawan ni Kablan ay naging mahabang isda na may matulis na nguso at matatalim na ngiping parang kakain kaninuman.

49. Nagalit ang diwata sa ginawa ng madamot na matanda.

50. She started a TikTok account to showcase her art and gain more exposure.

Recent Searches

nagulatshopeekartonhayaanputingcertainfacestoplightincreasesimpactedsimplengentrysiraforskeltumawagunattendedsystems-diesel-runnapuyatpaninigasadgangmedikalprocessartistspagsuboktungkodsantoskills,isinuotiyamottshirteveningnakapikitmagtanimhistorianatigilanitinulosnalalabiproudiconicsignyourself,automatiskpetsangadverseprimerbatojerrytheykapilingstoplegendsnasarapankongresopagsagotasignaturanaglarosaan-saankamandagnaiisipmateryalesengkantadangpahiramsundalogumawamakukulaypagamutantaga-hiroshimayumabongbutikiasiaanimokaibiganjacewidespreadvideofireworkssoonsellpakainsumabogestablishmasdanhydelroomshowsnahulicinenapabalikwassumarapbutiscalegitanasgovernmenttechnologicalelectedfourmultopointplatformsinilingareanerissarelievedcorrectingresourcescouldpepemagasawangnagkakasyapagkamanghamakakasahodnangangahoymumuranakatuwaangressourcernebangladeshnakikilalangnagngangalangagricultoreswalkie-talkiemakapangyarihangsportsvisualstrategiesfue1929ingatanteleviewingmadamibinawitradedalawapalapitfreevalleygraphicnakasuotnapatingalascottishgawingnapakamotkinauupuankanmahiwagangnapakasipagmakasilongkumikinigkarunungannasasabihangulathila-agawantatawagtiniradorpagkuwanagkasunogmonsignornanditoisamakatapatpinatiramatesaiyakplagasnenakontingdiaperdustpanmadalingpaldalalonglihimdiseasedibisyonbagaypagbabagong-anyomagta-trabahonamumulaklakpagkalungkotkumukuhanagkakatipun-tiponnaiyakmagnanakawuniversitypagkahapopumitasinjurysharmainepangungusappalaisipanikukumparanaulinigannakakarinigpagmamanehonaibibigaysasamahankapasyahanmakapalagsinasadyapamagatmag-usap