Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

28 sentences found for "research"

1. Additionally, be aware that not all opportunities on the internet are legitimate, so always do your own research before investing time or money into any opportunity

2. Ailments can be a source of inspiration for medical research and innovation to develop new treatments and cures.

3. But the point is that research in the field of the development of new energy sources must be carried on further and expedited so that the exhaustion of conventional sources of power does not adversely affect the growth of our economy and the progress of civilization

4. Cancer is a complex disease, and ongoing research and collaboration are essential for developing new treatments and improving patient outcomes

5. Cancer research and innovation have led to advances in treatment and early detection.

6. Einstein's legacy continues to inspire and influence scientific research today.

7. Hiram na libro ang ginamit ko para sa aking research paper.

8. Hospitalization can provide valuable data for medical research and innovation, leading to improved treatments and outcomes for future patients.

9. In conclusion, making a book is a creative and fulfilling process that requires planning, research, and hard work

10. Investing in the stock market can be risky if you don’t do your research.

11. Leukemia research continues to improve our understanding of the disease and develop more effective treatments.

12. Microscopes are commonly used in scientific research, medicine, and education.

13. Microscopes have helped us to better understand the world around us and have opened up new avenues of research and discovery.

14. Microscopes have played a critical role in the development of modern medicine and scientific research.

15. Musk has donated significant amounts of money to charitable causes, including renewable energy research and education.

16. Oscilloscopes are commonly used in electronics, telecommunications, engineering, and scientific research.

17. Quiero hacer una contribución significativa a la ciencia a través de mi investigación. (I want to make a significant contribution to science through my research.)

18. Research and analysis are important factors to consider when making investment decisions.

19. Research on viruses has led to the development of new technologies, such as CRISPR gene editing, which have the potential to revolutionize medicine and biotechnology.

20. Research: Depending on the subject of your book, you may need to conduct research to gather information and support your ideas

21. Scientific research has led to the development of life-saving medical treatments and technologies.

22. Scientific research has shown that meditation can have a positive impact on mental health.

23. Scientific research has shown that regular exercise can improve heart health.

24. She donated a significant amount to a charitable organization for cancer research.

25. Stock market investing carries risks and requires careful research and analysis.

26. The news might be biased, so take it with a grain of salt and do your own research.

27. The United States is a global leader in scientific research and development, including in fields such as medicine and space exploration.

28. The versatility and precision of oscilloscopes make them indispensable tools for electronic design, testing, and research.

Random Sentences

1. Ang sampaguita ang pambansang bulaklak ng Pilipinas.

2. Cheating can have devastating consequences on a relationship, causing trust issues and emotional pain.

3. Online learning platforms have further expanded access to education, allowing people to take classes and earn degrees from anywhere in the world

4. Ang pagbabalik ng kanyang pinakamatalik na kaibigan mula sa ibang bansa ay labis niyang ikinagagalak.

5. Bago pa man maghatinggabi ay dumating nga ang prinsipe at lubos na nalugod ang nag-aalalang prinsesa.

6. Dapat bigyang pansin ang kawalan ng seguridad sa trabaho ng mga manggagawa at magsasaka bilang bahagi ng sektor ng anak-pawis.

7. Nag mungkahi naman ang Mayor na dapat unahin munang bigyan ng ayuda ang mga senior citizens.

8. May naghubad na ng damit at isinampay na lamang sa balikat.

9. Halos magkasing-edad sila ni Bereti kaya madaling nagkalapit ang mga loob.

10. Mabuti pa makatayo na at makapaghilamos na.

11. At ako'y namulat sa hubad na katotohanan.

12. El nacimiento de un bebé es un momento de felicidad compartida con familiares y amigos.

13. Here are a few ideas to get you started: Freelancing: If you have a skill that others need, such as writing, graphic design, or programming, you can offer your services as a freelancer

14. Hindi dapat magbigay ng halaga sa mga kababawang bagay tulad ng kasikatan o kasikatan ng mga gamit.

15. Hindi namin mahanap ang tarangkahan ng bahay mo kaya't nag-text kami sa iyo.

16. My favorite April Fool's joke of all time was the time my cousin convinced her entire family that she had won the lottery.

17. Omelettes are a popular choice for those following a low-carb or high-protein diet.

18. LeBron James is a professional basketball player widely regarded as one of the greatest athletes of all time.

19. La realidad es que a veces no podemos controlar lo que sucede.

20. Dahil sa ugali ni Aya na hindi maganda, siya ngayon ay kinaiinisan ng mga taong dati ay sa kanya pumupuri.

21. Sa bawat hampas ng alon, tila naririnig ko ang panaghoy ng mga nawawala sa dagat.

22. Durante su carrera, Miguel Ángel trabajó para varios papas y líderes políticos italianos.

23. Sige maghahanda na ako ng pagkain.

24. Her lightweight suitcase allowed her to pack everything she needed for the weekend getaway without exceeding the airline's weight limit.

25. Dala ng hinagpis, nagdesisyon si Mario na magpakalayo-layo upang muling hanapin ang sarili.

26. Ang snob naman neto. Alam mo ba kung anong oras na?

27. Ang pagbabago ng pananaw at pag-iisip ay maaaring magdulot ng pagbabago sa pangamba.

28. Ang mga nanonood ay para-parang nangapatdan ng dila upang makapagsalita ng pagtutol.

29. Nag smile siya sa akin, at nag smile rin ako sa kanya.

30. Hindi ko kayang gawin yun sa bestfriend ko.

31. The experience of bungee jumping was both terrifying and euphoric.

32. Naghanda sila para sa kasal na gagawin sa bundok.

33. He is typing on his computer.

34. Sa gitna ng katahimikan ng gabi, narinig ang panaghoy ng isang inang nawalan ng anak.

35. Libro ko ang kulay itim na libro.

36. Das Gewissen kann uns helfen, die Auswirkungen unserer Handlungen auf die Welt um uns herum zu verstehen.

37. The symptoms of pneumonia include cough, fever, and shortness of breath.

38. The sun is not shining today.

39. Nakarating na kami sa aming pupuntahan.

40. The team captain is admired by his teammates for his motivational skills.

41. Ang hinagpis ng isang ina ay dama sa kanyang bawat hikbi habang inaalala ang kanyang nawalang anak.

42. Con paciencia y dedicación, se puede disfrutar de una deliciosa cosecha de maíz fresco

43. Maraming mga artist ang nakakakuha ng inspirasyon sa pamamagitan ng pagguhit.

44. Después de estudiar el examen, estoy segura de que lo haré bien.

45. Tumayo siya tapos umalis na. umuwi na rin ako ng bahay.

46. Walang pagtutol sa mga mata ng mga ito.

47. Pinanood namin ang Ifugao kahapon.

48. My dog hates going outside in the rain, and I don't blame him - it's really coming down like it's raining cats and dogs.

49. Ang mga akda ni Rizal tulad ng "Noli Me Tangere" at "El Filibusterismo" ay naglalaman ng mga kritisismo sa pamamahala ng Espanya at nag-udyok sa rebolusyonaryong diwa sa Pilipinas.

50. Hindi ko mapigilan ang aking inis kapag nakikita ko ang kawalang-katarungan.

Similar Words

Research:research,

Recent Searches

researchmaaksidentehinanaptiningnantshirtoverflymahahabakubomahigitlaborbinabaliklilypaymagsisimulahahatollorenadonenagliwanaginalisnawalannamamayatmaipantawid-gutommalakingusenaghinalamanonoodaccederpacekumainiyansofaclientsibondadnaglabananexamplekumukulomagpaliwanageffectsagotautomaticmanuscriptipapaputolkapilingrevolutionizedbitiwanexcuseipanlinismangyarijulietpaguutosbakitnakikiafaktorer,advancesabipumupurinakaluhodpahabolganyanumagaperfecttasanapabayaanmaaringtumitigilnagkalapitsawsawannababakaspabigathumanspowercosechaitemsfatalsakoppagkainnamanghamasaganangmagpalibregospelbusiness,minerviedeletingcarbonreachhinilabarnesnaglutoonlypriestgamitinargueluziikliinvolveadmiredpagkakayakapnariyanfeltnamecanadanakalagaykagubatanoutlineextraverden,ramdamsineconvertidaspanunuksongusoawitanhimiggathertechnologyformskusinabirouniversitiesrabedomingomagigitingnagtalagasyatechnologicalmakilingeffortswastelosssiguradotulisancultivartaglagashumihingitransport,pagkakataongnaabotbranchesaccuracypalaisipanstoryfeedbacktelevisedkampeonpetsapapasamaissundaemanghulifinalized,magdasaadseguridadpag-aapuhapcompletamentenakainlegislationtagiliransistemasnakasandigmissionmaliliitstopnagdiretsorelevantbutihinginlovegodtrosariopag-amintumutubosasamatilikuryentekundiedadyoutoothbrushtibokpakaininbinatakrosaisipannahigabihasahalamanangnaglalakadirogmabatongmusicalesnag-aarallarangantapenagsmilemagnanakawroonmananalonamin