Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

28 sentences found for "research"

1. Additionally, be aware that not all opportunities on the internet are legitimate, so always do your own research before investing time or money into any opportunity

2. Ailments can be a source of inspiration for medical research and innovation to develop new treatments and cures.

3. But the point is that research in the field of the development of new energy sources must be carried on further and expedited so that the exhaustion of conventional sources of power does not adversely affect the growth of our economy and the progress of civilization

4. Cancer is a complex disease, and ongoing research and collaboration are essential for developing new treatments and improving patient outcomes

5. Cancer research and innovation have led to advances in treatment and early detection.

6. Einstein's legacy continues to inspire and influence scientific research today.

7. Hiram na libro ang ginamit ko para sa aking research paper.

8. Hospitalization can provide valuable data for medical research and innovation, leading to improved treatments and outcomes for future patients.

9. In conclusion, making a book is a creative and fulfilling process that requires planning, research, and hard work

10. Investing in the stock market can be risky if you don’t do your research.

11. Leukemia research continues to improve our understanding of the disease and develop more effective treatments.

12. Microscopes are commonly used in scientific research, medicine, and education.

13. Microscopes have helped us to better understand the world around us and have opened up new avenues of research and discovery.

14. Microscopes have played a critical role in the development of modern medicine and scientific research.

15. Musk has donated significant amounts of money to charitable causes, including renewable energy research and education.

16. Oscilloscopes are commonly used in electronics, telecommunications, engineering, and scientific research.

17. Quiero hacer una contribución significativa a la ciencia a través de mi investigación. (I want to make a significant contribution to science through my research.)

18. Research and analysis are important factors to consider when making investment decisions.

19. Research on viruses has led to the development of new technologies, such as CRISPR gene editing, which have the potential to revolutionize medicine and biotechnology.

20. Research: Depending on the subject of your book, you may need to conduct research to gather information and support your ideas

21. Scientific research has led to the development of life-saving medical treatments and technologies.

22. Scientific research has shown that meditation can have a positive impact on mental health.

23. Scientific research has shown that regular exercise can improve heart health.

24. She donated a significant amount to a charitable organization for cancer research.

25. Stock market investing carries risks and requires careful research and analysis.

26. The news might be biased, so take it with a grain of salt and do your own research.

27. The United States is a global leader in scientific research and development, including in fields such as medicine and space exploration.

28. The versatility and precision of oscilloscopes make them indispensable tools for electronic design, testing, and research.

Random Sentences

1. Omelettes are a popular choice for those following a low-carb or high-protein diet.

2. The patient's family history of high blood pressure increased his risk of developing the condition.

3. Inilagay nya sa poon ang biniling sampaguita.

4. Lingid sa kaalaman ng prinsesa gayundin ang nararamdaman ng bagong kakilala sa kanya.

5. Bagaimana caranya agar bisa memenangkan perlombaan ini? (What is the way to win this competition?)

6. Hindi dapat natin pigilan ang ating mga pangarap, kundi pagsikapan nating tuparin ang mga ito.

7. Algunas personas se dedican a crear arte como su profesión.

8. My birthday falls on a public holiday this year.

9. Inirekumenda ng guro na magsagawa kami ng mga field trip upang mas mapalawak ang aming kaalaman.

10. Ang mga sumusunod na salita ang nagsasabing siya ay pulubi.

11. Sa simula ng kabanata, ipinakilala ang bagong karakter na magiging pangunahing tauhan.

12. El Día de San Valentín es una festividad muy popular en muchos países.

13. Emphasis can be used to create a memorable and impactful message.

14. A penny saved is a penny earned.

15. Emphasis is an important tool in public speaking and effective communication.

16. Les algorithmes d'intelligence artificielle peuvent apprendre à partir de données et améliorer leur performance au fil du temps.

17. Påskelørdag er dagen, hvor Jesus lå i graven, og der afholdes ofte en stille og reflekterende gudstjeneste.

18. Los bebés recién nacidos tienen un olor dulce y tierno.

19. Si mommy ay matapang.

20. Bawal mag-drugs dahil ito ay nakakasama sa kalusugan at nakakadulot ng krimen.

21. While it has brought many benefits, it is important to consider the impact it has on society and to find ways

22. Los héroes inspiran a otros a levantarse y luchar por lo que es correcto.

23. Ang sugal ay isang maling paghahangad ng mga tao na magkaroon ng mabilis na yaman.

24. Sa pagguhit, mahalaga ang pagpili ng tamang kasangkapan tulad ng lapis, papel, at krayola.

25. His death was a shock to the world, and millions of fans mourned the loss of one of the most important figures in the history of martial arts

26. Technical analysis involves analyzing past market trends and price movements to predict future market movements.

27. Nasi goreng adalah salah satu hidangan nasional Indonesia yang terkenal di seluruh dunia.

28. Napakaganda ng mga pasyalan sa bansang Singapore.

29. Naging mayabong ang kaalaman ng tao dahil sa teknolohiya.

30. If you are self-publishing, you will need to choose a platform to sell your book, such as Amazon Kindle Direct Publishing or Barnes & Noble Press

31. Mahilig akong kumanta ng mga awiting gawa ng Bukas Palad.

32. Huwag daw siyang makikipagbabag.

33. The website has a section where users can leave feedback and suggestions, which is great for improving the site.

34. Iba ang landas na kaniyang tinahak.

35. She has made a lot of progress.

36. Es importante ser cuidadoso con la información personal que se comparte en las redes sociales.

37. Bumili ako ng prutas sa Berkeley Bowl.

38. Bumili ako ng lapis sa tindahan

39. Grover Cleveland, the twenty-second and twenty-fourth president of the United States, served from 1885 to 1889 and from 1893 to 1897, and was known for his economic policies and opposition to corruption.

40. Hendes livsstil er så fascinerende, at jeg ønsker at lære mere om hende. (Her lifestyle is so fascinating that I want to learn more about her.)

41. Grabe ang lamig pala sa South Korea.

42. It is one of the most important inventions in human history, as it has revolutionized the way we communicate and has played a crucial role in shaping modern society

43. La science a permis des avancées significatives dans la médecine.

44. Hindi na kasya sa silid-aralan ang mga libro kaya nagpasya ang paaralan na magkaroon ng bagong library.

45. Hanggang maubos ang ubo.

46. Today, television advertising is a multi-billion dollar industry, and it plays a crucial role in many companies' marketing strategies

47. Doa juga bisa digunakan sebagai sarana untuk meminta keberanian dan kekuatan menghadapi tantangan hidup.

48. Nag-aalalang sambit ng matanda.

49. Hindi rin niya inaabutan ang dalaga sa palasyo sa tuwing dadalawin niya ito.

50. Después del nacimiento, el bebé será evaluado para asegurarse de que está sano y para determinar su peso y tamaño.

Similar Words

Research:research,

Recent Searches

researchpedromeetnowcommunitysabihingtelangjeromepasangcebusorryhumanospetsasinagotisladevicescountriesthroughouttripauditkinukuyomlibingpacetermshouldhellopinilinggrabeprogrammingipinalitleadfallpowerpointhilingmagpagupitdahilperoatensyoncarenakaratinghumahangospasyapagsasayapagoddietsakityungmahiwagangkongathenanauntogsusnagmungkahiumiyakhalamananiwanpumupuntabalikbobopumitasnakagagamotnapagtantochecksupuanusasofaayonsmilemuchosiyopanunuksoobra-maestrakumantacellphoneyannakakapamasyalayospagsumamomakakakaingumigisingikinalulungkotpagtiisanmagkaibiganhinagud-hagodmagkakagustotime,dagat-dagatanpicsmakipagtagisanmagworknananalongpinakidalalalakimaipagmamalakingpaki-chargebiologirevolutioneretumagawpinigilannapasubsobpagkuwanprodujotinakasanhalu-halomaghintaykinakabahannababalotpaninigasregulering,automatiskmaghaponhouseholdtinungokangkonginiisipika-50industriyaafternoonipinauutangkesominatamispaakyatpulgadacantidadnapadpadadvancementniyogpagmasdanyumanigdilimmanggatypewikangipingkenjinapadaanarabiamahigpitengkantadamatangkadnetflixkalawangingtibigejecutanmagnifyarkilayorksinakopdiretsomanuelawitilocosroselle1950spigingiconskumalassagapnaglabanan1954supilinbigyanmembersnasunogmakahingianywherefrescopieceslapitanlingidmorenamakaratinginantaybinatangnakabawijunjunmaputimalapitbakeupworkreducedkiloipinagbilingpollutionmainitartsaccedermemobisigmodernpitoitongnilimasngusodahilanilanrichcondobipolarrisk