Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

10 sentences found for "further"

1. Automation and artificial intelligence have further improved transportation, making it safer and more efficient

2. But the point is that research in the field of the development of new energy sources must be carried on further and expedited so that the exhaustion of conventional sources of power does not adversely affect the growth of our economy and the progress of civilization

3. Online learning platforms have further expanded access to education, allowing people to take classes and earn degrees from anywhere in the world

4. Oscilloscopes can capture and store waveforms for further analysis and comparison.

5. Patients may be discharged from the hospital once their condition has improved, or they may need to be transferred to another healthcare facility for further treatment.

6. Tesla has expanded its operations globally, with presence in various countries and plans for further expansion.

7. The introduction of the dial telephone in the 1920s further improved the telephone system, as it allowed for faster and more efficient call connections

8. The patient was referred to a specialist in leukemia treatment for further evaluation and care.

9. The rise of social media has further expanded the reach of the internet, allowing people to connect with friends and family, as well as share their thoughts and experiences with a global audience

10. These films helped to further cement Presley's status as a cultural icon and helped to solidify his place in the history of American entertainment

Random Sentences

1. Malaki ang lungsod ng Makati.

2. Pets, including dogs, can help children develop empathy and responsibility.

3. Nakakain ka ba ng mga pagkaing Pilipino?

4. The momentum of the car increased as it went downhill.

5. Sa lipunan, ang pagiging marangal at matapat ay dapat na itinuturing at pinahahalagahan.

6. Pagkatapos ng malagim na balita, natagpuan ko ang aking sarili na tulala sa kanyang kwarto.

7. Gusto kong malaman mo na may ganitong pakiramdam ako, kaya sana pwede ba kita ligawan?

8. The experience of bungee jumping was both terrifying and euphoric.

9. In some cultures, the role of a wife is seen as subservient to her husband, but this is increasingly changing in modern times.

10. Pinabulaanang muli ito ni Paniki.

11. Ang sugal ay isang mapanlinlang na industriya na nakatuon sa pagkuha ng pera mula sa mga manlalaro.

12. It’s risky to rely solely on one source of income.

13. Bahagya na niyang maulinigan ang ina.

14. Naisip niya na mas maganda kung nag-iisa siya sa bukid.

15. Transkønnede personer har ret til at udtrykke deres kønsidentitet uden frygt for vold eller diskrimination.

16. Kumalas ako sa pagkakayakap niya sa akin.

17. Ang kahusayan ng isang guro ay dapat na itinuring at kilalanin ng mga mag-aaral.

18. Market indices such as the Dow Jones Industrial Average and S&P 500 can provide insights into market trends and investor sentiment.

19. Maitim ang dugo ang madalas sabihin kapag masama ang isang tao

20. Oscilloscopes can capture and store waveforms for further analysis and comparison.

21. "Kapag may tiyaga, may nilaga" ay isang bukambibig na nagpapahiwatig ng kahalagahan ng pasensya at pagsisikap upang makamit ang tagumpay.

22. Trump's handling of the COVID-19 pandemic drew both praise and criticism, with policies like Operation Warp Speed aiming to accelerate vaccine development.

23. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

24. Nasi padang adalah hidangan khas Sumatera Barat yang terdiri dari nasi putih dengan lauk yang bervariasi.

25. La labradora de mi amiga es muy obediente y siempre viene cuando la llaman.

26. Ilang oras silang nagmartsa?

27. Umuuwi siya sa probinsiya linggo-linggo.

28. Sabay nanaog at pumitas ng halaman sa hardin at nagtuloy sa ilog upang pagmasdan ang bulaklak sa kanyang buhok.

29. Ngunit natatakot silang pumitas dahil hindi nila alam kung maaring kainin ito.

30. The dancers are not rehearsing for their performance tonight.

31. Kebahagiaan sering kali tercipta melalui perspektif positif, menghargai hal-hal sederhana, dan menikmati proses hidup.

32. Bawal magpaputok sa kalsada dahil ito ay nakakabahala sa kapayapaan ng mga tao.

33. Ang malakas na pagkokak ng mga Palaka at paghuni ng mga Kuliglig ay sumaliw sa awit ng mga Maya.

34. Las heridas en áreas articulares o que afectan nervios o vasos sanguíneos pueden requerir de intervención quirúrgica para su reparación.

35. La labradora de mi hermana es muy cariñosa y siempre está buscando atención.

36. Nasa page 5 ang mapa ng Metro Rail Transit.

37. Sa tapat ng posporo ay may nakita silang halaman na may kakaibang dahon.

38.

39. Mga prutas ang tinitinda ng tindera.

40. Di na ako magtataka dahil alam ko naman ang nangyari.

41. Scissors have handles that provide grip and control while cutting.

42. Ang tagumpay ng aking proyekto ay nagpawi ng aking mga pag-aalinlangan at pagdududa sa aking kakayahan.

43. I am enjoying the beautiful weather.

44. El cambio de gobierno produjo una reorganización completa de las instituciones.

45. Mahalaga na magpakatotoo ka sa mga taong bukas palad sa iyo upang mas maintindihan ka nila ng husto.

46. Pinagkakaguluhan lamang tayo ng mga tao rito ay wala namang nangyayari.

47. There were a lot of options on the menu, making it hard to decide what to order.

48. Eine klare Gewissensentscheidung kann uns helfen, uns selbst treu zu bleiben.

49. Limitations can be addressed through education, advocacy, and policy changes.

50. Es un cultivo versátil que se puede utilizar para hacer alimento para humanos y animales, y también se utiliza en la producción de biocombustibles

Recent Searches

kartonagefurtherpag-aaralnenadeveloptutorialsdoinghighestedituloshouldeffectsamazonmonitoriginitgitinteligenteshulingkapangyarihandapatmaligayataun-taonmagkasakitbumababasilaginhawaprinsipechecksdiscipliner,mensahemalayangmarketing:pamilyamakikipagbabaginordere-bookspagkacareerapatpamimilhinglilipaddinjudicialdisappointadverselygreenhillspagkagustomuchosperarolestylescontentreleasedestablishedsteerexitmonetizingarmedimpitredinformationdulalikelyipaghugasilingstyleparkepasigawkumantasasamanakasuotsupremepisoeuphoricbiglabalancesiiklilarowalonglaladyipkatedralagwadorvirksomheder,palipat-lipatkalalakihanmagta-trabahokinakitaankumukuhanangagsipagkantahansaranggolanakakatawapagka-maktolnakikilalangnakakadalawpinagsikapanmagkahawaknagpapaniwalapunongkahoymagbabakasyonkasalukuyanmagsalitaculturenakatagokalalaromagkakaroonmakuhangnaghuhumindigmakatatlomahihirapkapasyahanbusinessespagtutolfulfillingtobacconamulaklakmamanhikannamulatmagpapabunottravelermagtanghaliannagmakaawamakikipaglaronakakapasokkwenta-kwentainilalabasnabubuhaymakatarunganginirapanpagdukwangnapapasayanagsunuranmaglalaroeskuwelaunahinnagpalalimpagsalakaypahingalmaipapautanglinggongpaglalabanaglahomananalopangangatawantanggalinpagkabiglapansamantalamakukulaymanatiligustoangkanculturasdropshipping,hanapbuhayibinigaypagkagisingmakakabalikmakabawiengkantadangyouthnapatulalanailigtaskinalilibingantumamamahabangumigtadmaasahanfysik,vaccinestumatakbopaostumigilmadungislot,sasakaytheirkaratulangfulfillmenttagpiangmatumalnapansiniiwasannaglutobulalaskampanaorkidyasiyopinalalayaspalamutiroofstockhinatidhinagislalargamatutuloginiirogkargahankuligligmanakbomarangalinstrumental