Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

10 sentences found for "further"

1. Automation and artificial intelligence have further improved transportation, making it safer and more efficient

2. But the point is that research in the field of the development of new energy sources must be carried on further and expedited so that the exhaustion of conventional sources of power does not adversely affect the growth of our economy and the progress of civilization

3. Online learning platforms have further expanded access to education, allowing people to take classes and earn degrees from anywhere in the world

4. Oscilloscopes can capture and store waveforms for further analysis and comparison.

5. Patients may be discharged from the hospital once their condition has improved, or they may need to be transferred to another healthcare facility for further treatment.

6. Tesla has expanded its operations globally, with presence in various countries and plans for further expansion.

7. The introduction of the dial telephone in the 1920s further improved the telephone system, as it allowed for faster and more efficient call connections

8. The patient was referred to a specialist in leukemia treatment for further evaluation and care.

9. The rise of social media has further expanded the reach of the internet, allowing people to connect with friends and family, as well as share their thoughts and experiences with a global audience

10. These films helped to further cement Presley's status as a cultural icon and helped to solidify his place in the history of American entertainment

Random Sentences

1. The tech industry is full of people who are obsessed with new gadgets and software - birds of the same feather flock together!

2. Las escuelas ofrecen diferentes planes de estudios, dependiendo del nivel y la especialización.

3. Maganda ang mga bulaklak sa tagsibol.

4. Quiero expresar mi gratitud por tu paciencia y comprensión.

5. Pakibigay mo naman ang libro kay Anna para magamit niya sa kanyang takdang-aralin.

6. Hindi ko ho kayo sinasadya.

7. Ang tubig-ulan ay maaaring magdulot ng malinis na hangin sa pamamagitan ng pag-alis ng polusyon sa hangin.

8. Napakainit ng panahon kanina at biglaan kaming nagpasyang mag-swimming.

9. Sa bawat pagsubok, si Hidilyn Diaz ay laging naniniwala na ang pagsisikap ay susi sa tagumpay.

10. Upang makatiyak, isinama ng datu ang pinakamatapat na kawal nang dumating ang ikatlong gabi.

11. Las hojas de papel se pueden reciclar para hacer papel nuevo.

12. Ang Ibong Adarna ay patuloy na nakakaakit ng mga mambabasa sa ngayon dahil sa kanyang pagpapakita ng kagandahan ng kultura at panitikan ng Pilipinas.

13. Halos lahat ng pwede nyang bilihin ay nasa Lazada na.

14. Tuwang tuwa ang mga tao dahil magaganda ang kanilang ani.

15. The United States has a system of federalism, where power is divided between the national government and the individual states

16. Hindi ko kayang hindi sabihin sa iyo, sana pwede ba kitang mahalin?

17. Ang mga kawal nagsisilbi sa bayan upang protektahan ang mamamayan.

18. Wag mo nga akong lokohin. Sige na.

19. The backpack was so hefty, it felt like it weighed a ton.

20. Pumunta si Clara sa bahay ni Maria.

21. Ang guro ko sa agham ay mahusay sa pagpapaliwanag ng mga konsepto.

22. Magandang umaga po, Ginang Cruz.

23. El dibujo de la anatomía humana fue uno de los mayores intereses de Leonardo da Vinci.

24. Los agricultores pueden desempeñar un papel importante en la conservación de la biodiversidad y los ecosistemas locales.

25. Ang mga kundiman ay bahagi ng ating kultura at nagpapaalala sa atin ng halaga ng pagmamahal at pag-ibig sa ating kapwa.

26. Sin agua, los seres vivos no podrían sobrevivir.

27. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

28. May nagbigay sa amin ng biglaang free food sa opisina kanina.

29. Sa paglipat niya sa ibang bansa, kinailangan niyang mag-iwan ng mga kaibigan at pamilya.

30. They have studied English for five years.

31. Sa aming pagdiriwang ng buwan ng wika, nagkaroon kami ng pagtatanghal na nagpapakita ng kahalagahan ng bayanihan.

32. Have they finished the renovation of the house?

33. Malamig na pawis ang gumigiti sa kanyang noo at ang tuhod niya ay parang nangangalog.

34. Eh ano ba talaga problema sa bagong maid mo?

35. AI algorithms can be trained using large datasets to improve their accuracy and effectiveness.

36. Hindi ito maganda na maging sobrang takot sa lahat ng bagay dahil lamang sa agam-agam.

37. Ano ang ginagawa mo nang lumindol?

38. Sumimangot ako at humarap ulit sa labas.

39. Limitations can impact one's career, relationships, and overall quality of life.

40. Kapag tag-araw ay malaki-laki rin ang kinikita ng mga agwador.

41. Make sure to keep track of your sources so that you can properly cite them in your book

42. At nakuha ko kaagad ang attention nya...

43. Maganda ang website na ginawa ni Michael.

44. Nagpunta sa kumbento si Sister Jane.

45. Kebahagiaan sering kali tercipta melalui perspektif positif, menghargai hal-hal sederhana, dan menikmati proses hidup.

46. I admire my mother for her selflessness and dedication to our family.

47. This can be a great way to leverage your skills and turn your passion into a full-time income

48. Kami ay umalis ng kaharian para ipagamot si Helena.

49. Dala marahil na nakakamit ang lahat kaya may hinahanap si Bereti sa buhay.

50. I don't know if it's true or not, so I'll take it with a grain of salt until I have more information.

Recent Searches

bulongfurtherbumababanapatinginimbespagkakapagsalitakinamumuhiannahihilopambansangmagkabilangbestfriendmagsugalkamukhamaaringsasakyanpitumpongpanalanginnaglakadhimutoknaglahomayornaglokotatlumpungbansangpwedemakakiboprivatemagagandangnakahiganghouseholdssakimkapatawaranbackmakapalagnabubuhaynglalabamagawanakihalubilocruzcualquiertinataluntonmarasiganlondonpagkathiramgalaankarapatangmagisipnakauslinggrowthoperatepapelmasaksihanapollomusicalesvitaminnakabiladcommunicationsboracaykumidlatlalakimaibabalikbinanggamaitimlakasnagsunurankuyapumapaligidh-hoydahancurrentpinakamahalagangumingitfeedback,androidpocagisingdollyprosperunosproductionlagaslasisuboginamahigpitkaraokecantidadmagbigayperakapagsalatinguroawardbibilhinkambingkaybilisdedicationartetagaroonbagkussalbahepondotugonhmmmcubicleayokoexpertiseinakyatasiaticanihinnasahodbisig1954computere,estaramerikasantomostfreelancerperpektingusednamingoutlinesmagpuntawidespreadtvscoatpasokginisingcoinbaseipinabalikdependsummitfascinatingfullschoolviewstutorialsincludewhileeditorvisualremembergawingeksperimenteringpulisuwiasianaiiritangnakikiadumagundongkubyertosincluirantokshapingskills,terminodefinitivobobocashmakauwiroofstockpakakasalankinagagalakfriendmahiwagawatawatrocktumatakbomerlindaanibersaryo1982receptorlilyvidenskabatensyonundeniablepadabogmagnakawmahihiraptodobigasbagodietdisappointedbototilkasamaanpiecespagsisisikuryentelalopagsumamopansamantalanagkalapitpinagbigyanstrategiesnakauwinakatulogsingapore