Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

14 sentences found for "political"

1. Additionally, television news programs have played an important role in keeping people informed about current events and political issues

2. His presidency was marked by controversy and a polarizing political climate.

3. Musk has been involved in various controversies over his comments on social and political issues.

4. Nationalism is a political ideology that emphasizes the importance of the nation-state.

5. Political campaigns use television to reach a wide audience, and political debates and speeches are often televised

6. Politics in America refers to the political system and processes that take place in the United States of America

7. The concept of God has also been used to justify social and political structures, with some societies claiming divine authority for their rulers or laws.

8. The king's role is often ceremonial, but he may also have significant political power in some countries.

9. The political campaign gained momentum after a successful rally.

10. The stock market can be volatile and subject to fluctuations due to a variety of factors such as economic conditions, political events, and investor sentiment.

11. The United States has a complex political system, with multiple levels of government and political parties.

12. The United States has a history of social and political movements, including the Civil Rights Movement and the Women's Rights Movement.

13. This allows people to see their leaders and candidates in action, and it also allows for a more transparent political process

14. Women have been elected to political office in increasing numbers in recent years, though still underrepresented in many countries.

Random Sentences

1. Some coffee enthusiasts enjoy collecting different types of coffee beans and brewing methods to explore the variety of flavors and aromas that coffee has to offer.

2.

3. Hindi ako masyadong mahilig sa pagpupuyat sa hatinggabi dahil masama ito sa kalusugan.

4. Pede bang itanong kung anong oras na?

5. Nahantad ang mukha ni Ogor.

6. Pinadala na nya ang kanyang resignation letter sa pamamagitan ng email.

7. La agricultura sostenible es una práctica importante para preservar la tierra y el medio ambiente.

8. Pangkaraniwang Araw sa Buhay ng Isang Tao

9. Es importante mantener las heridas cubiertas y protegidas de la suciedad y los agentes irritantes.

10. Tuwid ang tindig nito at halos hindi yumuyuko kahit may pasang balde ng tubig; tila sino mang masasalubong sa daan ay kayang-kayang sagasaan.

11. Mas mainit ang panahon kung walang hangin.

12. Kapag mayroong mga hindi inaasahang pangyayari sa buhay, madalas na nagkakaroon ng agam-agam sa mga tao.

13. The President is elected every four years through a process known as the presidential election

14. The tech industry is full of people who are obsessed with new gadgets and software - birds of the same feather flock together!

15. Nous allons avoir un photographe professionnel pour immortaliser notre mariage.

16. May sapot pa ng gagamba sa kanilang kisame.

17. Puwede ba bumili ng tiket dito?

18. Her album Thank U, Next was a critical and commercial success, debuting at number one on the Billboard 200 chart in 2019.

19. Saan ka nakatira? ang tanong ng pulis.

20. Nationalism can also lead to a sense of superiority over other nations and peoples.

21. Sigurado ka ba dyan, Kenji? tanong ng dad ni Athena

22. Sa kabila ng hirap, ang kanyang loob ay hindi kailanman naging mababa.

23. He used his good credit score as leverage to negotiate a lower interest rate on his mortgage.

24. They are not shopping at the mall right now.

25. Eto isuot mo. binigay ko sa kanya yung dress na binili ko.

26. Nakita ko sa facebook ang dati kong kaklase.

27. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

28. Nais sanang magbago ng isip si Magda, ngunit nanaig ang kanyang pagkagusto kay Damaso.

29. Ano ang ikinamatay ng asawa niya?

30. ¿Qué planes tienes para el Día de los Enamorados?

31. Andre helte er kendt for deres humanitære arbejde.

32. Napansin niya ang takot na takot na usa kaya't nagpasya ito na puntahan ito.

33. She was worried about the possibility of developing pneumonia after being exposed to someone with the infection.

34. Sa kabila ng pag-iisa, may mga taong handang tumulong sa kaniya.

35. Gusto ng ina na matuto si Pinang ng mga gawaing bahay, ngunit laging ikinakatwiran ni Pinang na alam na niyang gawin ang mga itinuturo ng ina.

36. Miguel Ángel es considerado uno de los artistas más influyentes de la historia del arte occidental.

37. Sa sobrang pagod, nagawa niyang paglimot sa mga pangyayari ng nakaraang araw.

38.

39. Some kings have been known for their military conquests, such as Alexander the Great and Napoleon Bonaparte.

40.

41. Los alimentos ricos en calcio, como los productos lácteos y el tofu, son importantes para la salud ósea.

42. A mi esposa le encanta hacer manualidades como pasatiempo.

43. Kumaripas ang delivery rider para maihatid ang order sa takdang oras.

44. Promise babayaran kita in the future. sabi ko sa kanya.

45. Ang taong hindi marunong lumingon sa pinanggalingan ay hindi makakarating sa paroroonan.

46. Sin agua, los seres vivos no podrían sobrevivir.

47. The Discover feature on Instagram suggests accounts and content based on a user's interests and interactions.

48. Huwag mo nang papansinin.

49. God is often seen as the creator of the universe, with the power to influence and control natural phenomena and human destiny.

50. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

Recent Searches

politicalnakatirangnakangisieconomypagkuwanagsunuranpinabayaanmahawaankinauupuangkagalakankapangyarihangmakangitipatuyokinagalitannaka-smirknagwelgacalambatubigtambayannakatawagmaketrycyclesamakatuwidmakapag-uwikahuluganpumitaspangungusapnagtakanapakalusogtumatawagtinutopkusineropagpilinaghuhumindigmagagawakasiyahannag-iimbitanapaluhaendeligmababatidsundalonapakagandasumusulatincluirnakakainnaglahomauliniganarbejdsstyrkekumalmadiwatapagkainismarurumimahinamakakibonag-aasikasonakapagtaposmalipasospananglawkuwentoilalagaymakawalamagkasakittindamagpasalamatkondisyonsaan-saanlumilipadpakialampamumunoalongdesigningnanangispagsusulitnaiinismagbabalangitinakangisingtutusinipinauutangtig-bebeinteperyahannapansinculturasnakabibingingenviarnakatuonmuntikantiniklingmarangaleksport,akmangtuluyangpaaralangagamitmbricosmatagumpaypakistaninhalenakauslingmakilalagovernorssiopaoisipannatayoperseverance,lagaslasvariedadampliamakausapkundimantenidonuevosagabalbahagyangeroplanopromisenapadpadleveragegawabopolshahatipdesisyonanballmakainkauripinangyarihankaysaprosesostreetpaldamag-plantparoroonahumpaybagamamariloudisenyokaybilisnapadaantanawkamotenoonwidelytuvokasaysayankatibayangpagputipeppycnicopresleykanokulangnoongaddictiontinitindaisipiniigibmasipagmuntinlupawritingnag-iyakantumayobilangreallabaspalawanfallatsongmagisingbuenamaaarihumblerevolutionizedlimangpadabogfrescokingdomwellmalihisltoilocosiconspaskongturonrestaurantsalariningatanpalapitmakasarilingdiagnoseslettermaduraspisoscottishwalahinogvelstandkasoadopted