Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

14 sentences found for "political"

1. Additionally, television news programs have played an important role in keeping people informed about current events and political issues

2. His presidency was marked by controversy and a polarizing political climate.

3. Musk has been involved in various controversies over his comments on social and political issues.

4. Nationalism is a political ideology that emphasizes the importance of the nation-state.

5. Political campaigns use television to reach a wide audience, and political debates and speeches are often televised

6. Politics in America refers to the political system and processes that take place in the United States of America

7. The concept of God has also been used to justify social and political structures, with some societies claiming divine authority for their rulers or laws.

8. The king's role is often ceremonial, but he may also have significant political power in some countries.

9. The political campaign gained momentum after a successful rally.

10. The stock market can be volatile and subject to fluctuations due to a variety of factors such as economic conditions, political events, and investor sentiment.

11. The United States has a complex political system, with multiple levels of government and political parties.

12. The United States has a history of social and political movements, including the Civil Rights Movement and the Women's Rights Movement.

13. This allows people to see their leaders and candidates in action, and it also allows for a more transparent political process

14. Women have been elected to political office in increasing numbers in recent years, though still underrepresented in many countries.

Random Sentences

1. Instagram also offers the option to send direct messages to other users, allowing for private conversations.

2. Nakaka-bwisit talaga ang nangyari kanina.

3. I caught my boyfriend staring at a picture of a pretty lady on his phone.

4. La esperanza nos ayuda a superar los obstáculos y desafíos que se presentan en nuestro camino. (Hope helps us overcome the obstacles and challenges that come our way.)

5. Ilan ang silya sa komedor ninyo?

6. Kapag nalulong ka na sa droga, mahirap nang magkamit ng kaganapan sa buhay.

7. Scientific evidence has revealed the harmful effects of smoking on health.

8. Hindi siya makapagtaas ng mabibigat dahil mababa ang kanyang timbang.

9. Ang pagsalungat sa agaw-buhay na sistema ng lipunan ay kailangan upang magkaroon ng tunay na pagbabago.

10. Mahigit sa walong oras siyang nagtatrabaho araw-araw upang matustusan ang kanyang mga pangangailangan.

11. Nag-uumigting ang kanyang mga ugat

12. Layuan mo ang aking anak!

13. Kaagad namang nakuha ng mangangahoy ang kanyang palakol kaya't nasugatan nito ang tigre sa leeg nito.

14. My mom always bakes me a cake for my birthday.

15. La alimentación saludable debe incluir una variedad de proteínas, carbohidratos y grasas saludables.

16. Investors with a higher risk tolerance may be more comfortable investing in higher-risk investments with the potential for higher returns.

17. Ayan sasamahan ka na daw ni Kenji.

18. Pare-pareho talaga kayo mga babaero!

19. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

20. Nogle helte går frivilligt ind i farlige situationer for at redde andre.

21. Ang pagdarasal o meditasyon ay nakagagamot sa aking kalooban at nagbibigay ng kapayapaan.

22. Nagtitinginan na sa amin yung mga tao sa paligid namin.

23. Mas masarap ang pulotgata kapag inilagay sa ibabaw ng bibingka.

24. Muchas empresas utilizan números de teléfono de línea directa o números de call center para brindar soporte técnico o atención al cliente

25. Born in San Francisco in 1940, Lee was raised in Hong Kong and began training in martial arts at a young age

26. She donated a significant amount to a charitable organization for cancer research.

27. Nakapagreklamo na ako sa pakete ko.

28. Close kasi kayo ni Lory. ngumiti sya na sobrang saya.

29. Masamang droga ay iwasan.

30. Nakakalungkot isipin na hindi na ako makakapakinig ng bagong awitin mula sa Bukas Palad dahil sa pagkawala ni Fr. Manoling.

31. Waring nag-aalinlangan siyang sagutin ang tanong ng guro.

32. The wedding ceremony usually takes place in a church or other religious setting.

33. They have sold their house.

34. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

35. Ipapainit ko ho ito sa kusinero namin.

36. At noon, higit kailanman, naging hamak sila sa pagtingin ng lahat.

37. Ano ang palitan ng dolyar sa peso?

38. La tos puede ser tratada con medicamentos, como jarabes para la tos y expectorantes.

39. All these years, I have been discovering who I am and who I want to be.

40. I do not drink coffee.

41. Bakit di mo 'to sinabi sa akin?

42. Hindi ko kayang isipin na hindi kita kilalanin, kaya sana pwede ba kita makilala?

43. Naglalakad siya sa parke araw-araw.

44. Es importante evitar rascarse o manipular las heridas para facilitar su cicatrización.

45. Magkano ang tiket papuntang Calamba?

46. She has been cooking dinner for two hours.

47. Agaw eksena ang babaeng himihiyaw sa palengke.

48. Sa kanyang masamang gawain, nai-record ng CCTV kung paano siya na-suway sa patakaran ng paaralan.

49. Nang makita ang paparating na ulan, kumaripas ng uwi ang mga bata mula sa palaruan.

50. Después del nacimiento, la madre necesitará tiempo para recuperarse y descansar, mientras que el bebé necesitará atención constante y cuidado.

Recent Searches

restaurantpoliticalsocialesulapgumandamanycompositoreslcdautomatiskgabrielmonetizingfuncionesmakakakainincitamenterulomagnifysamepalancadaangbusloteachernakapagreklamoreserbasyonnaiiritangreaderssuccessnakikilalangpinisilinstitucioneskina1980isasabadinaaminbihirameaningtoosynligeventaitinatapatsinimulanmaicokanya-kanyangnitosilid-aralanoncenecesitakwebanggodttalaganghulihansuwailkontraangnagbanggaanpinaghatidanmayniladesisyonanmabutikawili-wilipagpapautangtaga-nayonbecomemayamankailansinoganauulaminpagkagustokasakitkaramihangalaannewsnatalongangkanestiloslangyabluekaysasinkdalandanpamanpagkalitomansanastagumpayroquenaliligomahawaanwakaskabilangcantolegislationpalapagsanapagbatiduripisaracolourkaugnayannagagandahanpitumpongsinipangpaglalayagngitibinanggatanawnalugodpapanhikaddictionpitokahuluganinantayunangmagbabagsiknakakagalaaregladomaramotfulfillinginventionbroughtcarsmanilbihantarcilalaboroutmagagamitpriestspecifictatlokakutistumindiggraphichinanapcakeprovidednaglaonmaipagmamalakingencounteryunclienteaffectsinagotmakaratingmahigpitmahigittusindvisharieachmarmaingsalitangnakagalawparidiliginculturesnag-aaralkulunganpaglisanmabangobawallastingtumulonghagdananbutibilhinbinibinisciencepasasalamatpamagatsumasayawpapalapitmahiwagapinakamaartengwatchingkaurilandslideaudio-visuallysayringpalanabasamarianpinakabatanghousemarketplaceskatuwaanpagtataasbutikinakasandigcorporationagwadorpersonpinatirahanginkanikanilanghuertobakecultivoartistbusiness,naiilaganbuwenas