Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

14 sentences found for "political"

1. Additionally, television news programs have played an important role in keeping people informed about current events and political issues

2. His presidency was marked by controversy and a polarizing political climate.

3. Musk has been involved in various controversies over his comments on social and political issues.

4. Nationalism is a political ideology that emphasizes the importance of the nation-state.

5. Political campaigns use television to reach a wide audience, and political debates and speeches are often televised

6. Politics in America refers to the political system and processes that take place in the United States of America

7. The concept of God has also been used to justify social and political structures, with some societies claiming divine authority for their rulers or laws.

8. The king's role is often ceremonial, but he may also have significant political power in some countries.

9. The political campaign gained momentum after a successful rally.

10. The stock market can be volatile and subject to fluctuations due to a variety of factors such as economic conditions, political events, and investor sentiment.

11. The United States has a complex political system, with multiple levels of government and political parties.

12. The United States has a history of social and political movements, including the Civil Rights Movement and the Women's Rights Movement.

13. This allows people to see their leaders and candidates in action, and it also allows for a more transparent political process

14. Women have been elected to political office in increasing numbers in recent years, though still underrepresented in many countries.

Random Sentences

1. Pinagbubuksan ko ang mga bintana.

2. Dumadating ang mga guests ng gabi.

3. Isang umaga habang siya ay naglalakad patungo sa kanilang hardin ay may nakasalubong niya ang isang binata.

4. He has been writing a novel for six months.

5. James K. Polk, the eleventh president of the United States, served from 1845 to 1849 and oversaw the Mexican-American War, which resulted in the acquisition of significant territory for the United States.

6. Ang kanyang pagkanta ay animo'y pumapasok sa puso ng mga nakikinig.

7. Mahilig ang mga Pinoy sa masasarap na pagkain tulad ng adobo at sinigang.

8. Pagpasensyahan na daw niya ito dahil iyon na lamang ang natitira niyang pagkain.

9. Foreclosed properties can be a good investment opportunity for those who have the time and resources to manage a rental property.

10. The United States is a culturally diverse country, with a mix of ethnicities, languages, and religions.

11. Nangangaral na naman.

12. Ang umuulan nang malakas ay binulabog ang mga kalsada at nagdulot ng matinding baha.

13. Mi aspiración es ayudar a los demás en mi carrera como médico. (My aspiration is to help others in my career as a doctor.)

14. They have been renovating their house for months.

15. Les patients sont souvent admis à l'hôpital pour recevoir des soins médicaux.

16. Actions speak louder than words

17. Los niños de familias pobres a menudo no tienen acceso a una nutrición adecuada.

18. We have seen the Grand Canyon.

19. Virksomheder i Danmark, der eksporterer varer, er afgørende for den danske økonomi.

20. En la realidad, las cosas no son siempre en blanco y negro.

21. Hinawakan ko yung tiyan ko, Konting tiis na lang..

22. Leukemia can be acute or chronic, depending on how quickly the disease progresses.

23. Lumayo siya sa amin, waring nais niyang mapag-isa.

24. Investing in stocks or cryptocurrency: You can invest in stocks or cryptocurrency through online platforms like Robinhood or Coinbase

25. Les maladies chroniques telles que l'asthme, l'arthrite et le syndrome de fatigue chronique peuvent affecter la qualité de vie d'une personne.

26. The Statue of Liberty in New York is an iconic wonder symbolizing freedom and democracy.

27. Natalo ang soccer team namin.

28. Sa isang linggo ay pupunta kami sa Singapore.

29. La voiture rouge est à vendre.

30. Quitting smoking can improve one's health and reduce the risk of developing smoking-related illnesses.

31. Pakibigay na lang ang mensahe ko kay Miguel kung hindi ko siya maabutan.

32. Einstein's theory of general relativity revolutionized our understanding of gravity and space-time.

33. They have bought a new house.

34. May anak itong laging isinasama sa paglalaba.

35.

36. Sa tabing-dagat, natatanaw ko ang mga isda na lumilutang sa malinaw na tubig.

37. Some critics argue that television has a negative impact on children, as it can lead to decreased attention spans and a lack of physical activity

38. El discurso del político está llamando la atención de los votantes.

39. Napadungaw siya sa bintana upang tingnan ang magandang tanawin.

40. Where we stop nobody knows, knows...

41. Inflation kann auch durch eine Erhöhung der Nachfrage nach bestimmten Waren und Dienstleistungen verursacht werden.

42. Si Gng. Cruz ay isang guro sa asignaturang Filipino.

43. Omelettes are a popular choice for those following a low-carb or high-protein diet.

44. Sweetness can be used to mask other flavors and create a more palatable taste.

45. The wedding cake was beautifully adorned with fresh flowers.

46. Ailments can be prevented through healthy habits, such as exercise, a balanced diet, and regular medical check-ups.

47. I am not reading a book at this time.

48. Ano ang suot ng mga estudyante?

49. Nagsisilbi siya bilang public servant upang matugunan ang pangangailangan ng kanyang nasasakupan.

50. Magkakaroon umano ng libreng bakuna sa susunod na buwan ayon sa DOH.

Recent Searches

politicalpagamutanumakbayo-onlineabundanteactualidadfitnesssinasabinami-missmagdamagankapasyahankahuluganpagkainisinsektongmanghikayathumiwalaydoble-karanakasandignakapaligidmakapagsabinagkasunognag-angatmahawaannagmamadalit-shirtmahalgagamitkilaybirthdaypumikitligayamagpakaramiginawanginiresetatumindigtagpiangngitinagwaliscanteennakakaanimmaabutannatinagnakabluegawinpartspeksmanlumutangnangyaripaghuhugaskamandagqualityreleasedvisualinvolvepublishedmotiondumatingviewsoverviewipapahingapotentialdevicespumuntapinalutosumamaprovelabordalandaninantokshopeediamondiskobabessinunodcardbuwiskeeppaki-chargehinagud-hagodbobomakabiliprimerosgenerationerkaawa-awangkumapitsilangsulinganulomagselosika-50malambingmatangkadcontrolalapitanprinsipengamoynararanasanalignssiyang-siyamartialkategori,nagkakakainhimselfpinisilincitamenterbagalfriendsistersimbahanlawsmalinisdailymahiwagahapag-kainankulunganhagdananculturesinteractadventprovidedinspirasyonulamphilanthropynagtungoplatformse-commerce,sinuotbutiyumabongtemperaturadollyreportmagsi-skiingbalesagotkabilangumiimikamericapinangyarihancommunicationswalabumangonclientskababalaghangginoongfeedbackakmangfavorrewardingnaglabavaliosatanghalimanakbotienensiopaomaingatautomationenerosocialekahusayankamustaproudnetflixlihimricotulangnagpepekekarwahengpalabuy-laboyalbularyokarununganhinipan-hipannagkakasyakinikitanagpaalammagpalibreagam-agamrestawrannakakatawapagpapaalaalaunibersidadsportsgayunpamanlumabaspagtatakasenadorkanginapagkaawajingjingumiyakkaninumannapakagandanaglarotaglagashayaangmagpagupitbrancher,pagkabiglalandlinearbejdsstyrke