Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

14 sentences found for "political"

1. Additionally, television news programs have played an important role in keeping people informed about current events and political issues

2. His presidency was marked by controversy and a polarizing political climate.

3. Musk has been involved in various controversies over his comments on social and political issues.

4. Nationalism is a political ideology that emphasizes the importance of the nation-state.

5. Political campaigns use television to reach a wide audience, and political debates and speeches are often televised

6. Politics in America refers to the political system and processes that take place in the United States of America

7. The concept of God has also been used to justify social and political structures, with some societies claiming divine authority for their rulers or laws.

8. The king's role is often ceremonial, but he may also have significant political power in some countries.

9. The political campaign gained momentum after a successful rally.

10. The stock market can be volatile and subject to fluctuations due to a variety of factors such as economic conditions, political events, and investor sentiment.

11. The United States has a complex political system, with multiple levels of government and political parties.

12. The United States has a history of social and political movements, including the Civil Rights Movement and the Women's Rights Movement.

13. This allows people to see their leaders and candidates in action, and it also allows for a more transparent political process

14. Women have been elected to political office in increasing numbers in recent years, though still underrepresented in many countries.

Random Sentences

1. Hindi naman siya masyadong maarte pero ayaw niya ng mga gusot sa kanyang mga damit.

2. Ipinatawag nila ang mga ito at pinagkasundo.

3. Los juegos de mesa son un pasatiempo divertido para jugar en familia o con amigos.

4. Ano ang suot ng mga estudyante?

5. Lucas.. sa tingin ko kelangan na niyang malaman yung totoo..

6. Papanhik din sana siya sa tuktok ng burol subalit naabot siya ng rumaragasang tubig-ulan na lalong nagpalalim sa dagat-dagatan.

7. Tengo escalofríos. (I have chills.)

8. L'inflation peut affecter la valeur de l'argent au fil du temps.

9. Nagsisilbi siya bilang guro upang ituro sa kanyang mga estudyante ang tamang edukasyon.

10. Nagpuntahan ang mga tao roon at hinukay ang ugat ng puno.

11. La música puede ser utilizada para fines políticos o sociales.

12. Magkita po tayo pagbisita ko riyan.

13. Drømme kan være en kilde til trøst og håb i svære tider.

14. Cigarettes made of tobacco rolled in tissue paper helped spread a very harmful habit among the so-called advanced countries of the West

15. The telephone also played a role in the development of recorded music, as it allowed people to hear music over the phone

16. Puwede ba tayong magpa-picture na magkasama?

17. She is not studying right now.

18. The United States has a strong tradition of individual freedom, including freedom of speech, religion, and the press.

19. Maingat na nangampanya ang mga kandidato ayon na rin sa alituntunin ng IATF.

20. Hindi niya inaasahan na mag-iwan ng malaking marka sa kanyang komunidad ang kanyang paglilingkod.

21. Nakatitig siya sa tatlo pa niyang kapatid.

22. Su obra también incluye frescos en la Biblioteca Laurenciana en Florencia.

23. Los héroes son capaces de cambiar el curso de la historia con sus acciones valientes.

24. Uh huh, are you wishing for something?

25. Las heridas en zonas sucias o contaminadas pueden aumentar el riesgo de infección y requerir una limpieza más exhaustiva.

26. Mathematics is the study of numbers, quantities, and shapes.

27. Les personnes âgées peuvent faire face à la fin de leur vie avec courage et dignité.

28. Ang poot ang nagpapahirap sa aking isipan at pumupukaw sa aking mga kilos.

29. Ayos ka lang ba mahal ko, bakit parang namumutla at namamayat ka? tanong ng binata.

30. Bite the bullet

31. However, there are also concerns about the impact of technology on society

32. They analyzed web traffic patterns to improve the site's user experience.

33. Dadalawin ko ang aking mga alagang palaka sagot ng dalaga

34. Binibigyang halaga ng mga Pilipino ang talambuhay ni Ninoy Aquino bilang isang martir at simbolo ng demokrasya.

35. Mahalaga ang papel ng edukasyon sa pagpapalawig ng kaalaman at oportunidad para sa sektor ng anak-pawis.

36. Ang mga engineer nagsisilbi upang mag-disenyo at magtayo ng mga imprastraktura para sa publiko.

37. La labradora de mi tía es muy inteligente y puede hacer trucos increíbles.

38. Sinigurado ko na mayroon akong sapat na oras bago magdilim sa dakong huli ng araw.

39. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

40. Saan ka galing? bungad ni Maico saken pagpasok ko s condo.

41. Ang simbahan ay hitik sa mga deboto tuwing Linggo.

42. Ang abilidad sa pangangalaga ng kalusugan ay mahalaga upang mapanatili ang malusog na pamumuhay.

43. However, the quality of the data used to train AI algorithms is crucial, as biased or incomplete data can lead to inaccurate predictions and decisions.

44. The website's user interface is very user-friendly and easy to navigate.

45. Sa bawat pagsubok na dumarating, palaging may aral na natututunan.

46. Na-curious ako kaya't nag-google na lang ako upang malaman ang sagot.

47. The United States has a system of government based on the principles of democracy and constitutionalism.

48. Si Mabini ay isa sa mga pinakamatatalinong lider sa panahon ng himagsikan sa Pilipinas.

49. TikTok has become a cultural phenomenon, with its own language and trends that have spilled over into mainstream culture.

50. Dapat bigyang-pansin ang pangamba ng mga bata at tulungan silang maunawaan ang mga posibleng banta.

Recent Searches

kaaya-ayangpoliticalhealthiernagpapaigibmagkahawakkinakitaandaysecarsesumayaenviarhinahanapmahiwagaelectempresasnaguusapemphasizedguerreromoneyinumindispositivosbutkarnabalnakasakitpagkainishimihiyawvillagesaringnakatagoambisyosangpagkasabikwartotemparaturakuwadernomagdaraostumikimmasyadonghanapbuhaymakakabalikkolehiyopamumunotumiranaglulutonagpipiknikalbularyotigilsiyudadbintanacleanpagbibiropalasyoproducerersiguradokampanakakilalanagsamathroatbenefitsrestawanleeother3hrsmagkanopatawarinkubodesdeculturadagat-dagatancondohatingtransmitssiglopwestodiamondkasalukuyanclassesibabawhinugotpaglayasmaluwaguniversitieskamalianvaliosacynthiasusunodinhalesayashadessidomaglabaawitinbunutannalalabiipinangangakdumilatebidensyapinalambotsilbingtoysalatkasaysayankakahuyanenergibahaymariasinebinibilangtokyokatagalanilagayipantalopfriendbecomingdatapuwapalagayuncheckednandundinalawguidancesikipprosesotanganheytiyanbuwayamagdaantawananmamarilpaggawaconvertingcountlessitinalagangiyonuusapanbirostatuswifiself-defensetsssplacepinagkasundoexpresanindividualsartefonoelenanapapikitipinamilianghelairconneed,democracybalancesinulittressuotcomputere,manghulirestaurantleadingmulighedsamfundritoartskainbukodcupidtwitchokayamoayanredigeringbinawiannauliniganlitsonmagpakaramiklimaminatamishinihilingmarinigsuwailjamesbuwanpumatolmagkakaroondaysdemocraticdolyaribalikreducedantokloriconvertidasdalandanritwalcryptocurrency:kaano-anopasanhearmadurastalent