Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

21 sentences found for "tela"

1. A medida que la tecnología avanzó, se desarrollaron nuevos tipos de teléfonos, como los teléfonos inalámbricos, los teléfonos móviles y los teléfonos inteligentes

2. Además, el teléfono ha sido una herramienta valiosa en la venta telefónica y en la realización de encuestas

3. Ang mag-asawa ay may hanapbuhay na paghahabi ng mga tela.

4. Ang pasya nang pagkapanalo ay sa tela ng matanda.

5. At habang lumalaki na nga ang bata ay unti-unti itong naging bihasa sa paghahabi ng mga tela.

6. Baka nga si Amba pa gumawa ng tela aniya.

7. El powerbank es una solución conveniente para cargar teléfonos móviles, tabletas u otros dispositivos en movimiento.

8. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

9. El teléfono es un dispositivo electrónico que permite la comunicación a distancia mediante el uso de señales de sonido

10. El teléfono también ha tenido un gran impacto en la forma en que las empresas se comunican con sus clientes

11. En resumen, el teléfono es un dispositivo electrónico que permite la comunicación a distancia mediante el uso de señales de sonido

12. Igigiit nito na ang matanda ay nandaya at baka ipinalit lamang ang isang nagawa nang tela sa ginagawa nito.

13. La conexión a internet se puede hacer a través de una variedad de dispositivos, como computadoras, teléfonos inteligentes y tabletas.

14. Los powerbanks son populares entre los usuarios de teléfonos móviles y otros dispositivos electrónicos.

15. Los teléfonos inteligentes son una evolución de los teléfonos móviles y ofrecen aún más funciones y capacidades

16. Los teléfonos móviles también ofrecen una variedad de funciones adicionales, como la capacidad de enviar y recibir mensajes de texto, tomar fotos, acceder a internet y utilizar aplicaciones

17. Los teléfonos móviles, también conocidos como celulares, son probablemente los tipos de teléfonos más comunes en la actualidad

18. Muchas empresas utilizan números de teléfono de línea directa o números de call center para brindar soporte técnico o atención al cliente

19. Naging mayaman din ang mag-anak dahil sa mga bentang tela na ginagawa ng bata.

20. Sa anong tela gawa ang T-shirt?

21. Sa anong tela yari ang pantalon?

Random Sentences

1. Sa sarili, nausal niyang sana'y huwag siya ang maging paksa ng paghaharutan at pagkakatuwaan ng mga agwador.

2. Marunong nang maglinis at magtago ang mga taong marurumi.

3. Ngunit lingid kay Roque, may namumuong lihim na pagkagusto sina Magda at Damaso sa isa't isa.

4. Es importante leer las etiquetas de los alimentos para entender los ingredientes y la información nutricional.

5. She does not smoke cigarettes.

6. Some kings have been deposed or overthrown, such as King Louis XVI of France during the French Revolution.

7. Isang araw, habang nangangahoy si Mang Kandoy, nakakita ito ng isang kweba sa gitna ng kagubatan.

8. Ang magnanakaw ay nasakmal ng aso ng may-ari habang tinutukan siya ng baril.

9. Tuwing sabado ay pumupunta si Nicolas sa palasyo para dalawin si Helena.

10. Players move the ball by dribbling, passing, or shooting it towards the basket.

11. Seguir nuestra conciencia puede ser difícil, pero nos ayuda a mantenernos fieles a nuestros valores y principios.

12. He also believed that martial arts should be used for self-defense and not for violence or aggression

13. Masarap ang pagkakaluto mo ng kare-kare.

14. Sometimes I wish I could go back to a time when I didn't know so much about the world - ignorance is bliss, after all.

15. Ang pagpapakalbo ng kagubatan ay isa sa mga pangunahing dahilan kung bakit nagkakaroon ng pagkawala ng mga punong-kahoy.

16. En af de vigtigste drivkræfter i den danske økonomi er eksporten

17. Scientific research has led to the development of life-saving medical treatments and technologies.

18. Leukemia is a type of cancer that affects the blood and bone marrow.

19. Nagsisilbi siya bilang security guard upang protektahan ang mga tao at ari-arian.

20. ¿Puede hablar más despacio por favor?

21. Ang daming pulubi sa Luneta.

22. Sa facebook ay madami akong kaibigan.

23. Sa kasalukuyang panahon ang bayabas, bukod sa ito ay kinakain o pagkapitas sa puno, ito rin ay ipinansasahog sa ating mga lutuin.

24. Madaming squatter sa maynila.

25. Ang kuripot mo naman, minsan lang ako magpalibre eh.

26. Kailangang di niya malimutan ang araw na ito.

27. Maaring ibigay ng guro ang libro sa akin.

28. Binigyan niya ng kendi ang bata.

29. Mga bopols! Tape lang hindi nyo pa nagawang makabili!

30. Einstein was known for his sense of humor and his love of sailing.

31. Dalam beberapa kasus, orang tua bayi dapat meminta bantuan dukun bayi untuk merawat anak mereka.

32. Oh gosh. Inintay pa sya ng prince, what does it mean?

33. Nang maglalabing anim na taon na si Rabona ay may nakita siyang isang pusa sa kagubatan.

34. Saan pumupunta ang manananggal?

35. Lights the traveler in the dark.

36. La anaconda verde es una de las serpientes más grandes del mundo y es conocida por su capacidad para aplastar a sus presas.

37. Cuídate mucho en el camino, maneja con precaución y no te distraigas.

38. Palibhasa ay mahusay sa paglutas ng mga komplikadong mga teknikal na problema.

39. Eating fresh, unprocessed foods can help reduce the risk of heart disease and diabetes.

40. Magbantay tayo sa bawat sulok ng ating bayan.

41. Walang matigas na tinapay sa gutom na tao.

42. Marahil anila ay ito si Ranay.

43. Kapag mayroong sakit sa ngipin, kailangan mong magpakonsulta agad sa dentista.

44. Emphasis can be used to contrast ideas or draw attention to a particular aspect of a topic.

45. She has been cooking dinner for two hours.

46. Aalis siya sa makalawa ng umaga.

47. Facebook has faced controversies regarding privacy concerns, data breaches, and the spread of misinformation on its platform.

48. Really? What is he doing sa tapat ng room natin?

49. La crisis económica produjo una gran inflación que afectó a los precios.

50. The sun is not shining today.

Similar Words

Compostelatelang

Recent Searches

telakumirotmakabilimanirahanarayipasokmultoditomahinahongkantahansukatinlalakekinauupuanhousepinag-usapanfauxuwipalitannakaririmarimkayotulisannapatigilklasengiintayinjocelynpakaininkalahatingabangpagkatikiminveststringskybakasyonumigtadednaprimerasmatutuwapapapuntapermitenkuwebamagbibiladinformationjackpresleynatinthroughoutflamencogospelexpertmagbabalasocialescurtainsestudiomasayaenviaropgaver,halu-halopowertupelomonetizingmarvintutusinbroadcastssinaililibresemillasjanekablanmicaumamponmaabutanpagkanai-dialjackytoolmwuaaahhpitumpongsamekamakailannanakawanfuepinapatapostagalogaplicacionesjenynagnakawmakawalabarrocochesscoat1876unitedwhetherasongsubject,namingraphicmalumbaylangmapilitangnami-misspartieslingidsiglonapatayocitecompletingkasiyahangnagwagiglobalisasyonpalancalinggoailmentspoolgovernmentwaynaglalakadfrapneumoniaomeletterosellenagawatenidonabigaynyaadakongnagmumukhateachnapamarahangkindlestudentstuvogenerosityinspirationmulingnapilitanghinintaysisentamarielpaggitgitpopularizekumukuhanilangpagamutannakakatawamakapagsabitigileverythingkonsyertokumantamasasakitnamumuongbabayarangawafreelancing:lilikosimbahannangangaloggantingma-buhayna-fundriquezasiempretoonapagodeksamenaudio-visuallyreaksiyonnapakaalatvarietylucyoverallplatformsiniresetaimpeniniligtasrenatocontentnahuhumalingprogramahudyatpakilagaymangangalakalnaramdamanstillsapagkatmarahilsulatnaggalahigitkaynerissapaceasawamabaitkausapinbinigyanlights