Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

22 sentences found for "tela"

1. A medida que la tecnología avanzó, se desarrollaron nuevos tipos de teléfonos, como los teléfonos inalámbricos, los teléfonos móviles y los teléfonos inteligentes

2. Además, el teléfono ha sido una herramienta valiosa en la venta telefónica y en la realización de encuestas

3. Ang mag-asawa ay may hanapbuhay na paghahabi ng mga tela.

4. Ang pasya nang pagkapanalo ay sa tela ng matanda.

5. At habang lumalaki na nga ang bata ay unti-unti itong naging bihasa sa paghahabi ng mga tela.

6. Baka nga si Amba pa gumawa ng tela aniya.

7. El powerbank es una solución conveniente para cargar teléfonos móviles, tabletas u otros dispositivos en movimiento.

8. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

9. El teléfono es un dispositivo electrónico que permite la comunicación a distancia mediante el uso de señales de sonido

10. El teléfono también ha tenido un gran impacto en la forma en que las empresas se comunican con sus clientes

11. En resumen, el teléfono es un dispositivo electrónico que permite la comunicación a distancia mediante el uso de señales de sonido

12. Igigiit nito na ang matanda ay nandaya at baka ipinalit lamang ang isang nagawa nang tela sa ginagawa nito.

13. Kailangang salatin mo ang tela para malaman kung gaano ito kalambot.

14. La conexión a internet se puede hacer a través de una variedad de dispositivos, como computadoras, teléfonos inteligentes y tabletas.

15. Los powerbanks son populares entre los usuarios de teléfonos móviles y otros dispositivos electrónicos.

16. Los teléfonos inteligentes son una evolución de los teléfonos móviles y ofrecen aún más funciones y capacidades

17. Los teléfonos móviles también ofrecen una variedad de funciones adicionales, como la capacidad de enviar y recibir mensajes de texto, tomar fotos, acceder a internet y utilizar aplicaciones

18. Los teléfonos móviles, también conocidos como celulares, son probablemente los tipos de teléfonos más comunes en la actualidad

19. Muchas empresas utilizan números de teléfono de línea directa o números de call center para brindar soporte técnico o atención al cliente

20. Naging mayaman din ang mag-anak dahil sa mga bentang tela na ginagawa ng bata.

21. Sa anong tela gawa ang T-shirt?

22. Sa anong tela yari ang pantalon?

Random Sentences

1. Bilang paglilinaw, ang event ay para sa lahat, hindi lang sa mga miyembro ng organisasyon.

2. He does not waste food.

3. The host introduced us to his wife, a beautiful lady with a charming personality.

4. Ano ang nasa bulsa ng bag niya?

5. Ang kalawakan ay punung-puno ng mga bituin.

6. A veces tengo miedo de tomar decisiones, pero al final siempre recuerdo "que sera, sera."

7. I know I should have gone to the dentist sooner, but better late than never.

8. Sa aming probinsya, makikita mo ang mga bukid na mayabong na mga tanim.

9. Sometimes I wish I could go back to a time when I didn't know so much about the world - ignorance is bliss, after all.

10. Before a performance, actors often say "break a leg" to each other for good luck.

11. Kasintahan ka ba nitong aking apo? tanong ni Lola.

12. Electric cars, also known as electric vehicles (EVs), use electricity as their primary source of power instead of gasoline.

13. Luluwas ako sa Maynila sa Biyernes.

14. Nag-aalalang sambit ng matanda.

15. Después del nacimiento, el bebé puede ser amamantado o alimentado con fórmula, dependiendo de las preferencias de los padres y la salud del bebé.

16. Think about what message you want to convey, who your target audience is, and what makes your book unique

17. May bumisita umano sa bahay nila kagabi ngunit hindi nila nakita kung sino.

18. Sadyang kaunti lamang ang alam kong mga lenggwahe.

19. Los héroes pueden ser aquellos que defienden los derechos humanos y luchan contra la opresión.

20. Verified accounts on Twitter have a blue checkmark, indicating that they belong to public figures, celebrities, or notable organizations.

21. Smoking is a global public health issue that requires ongoing efforts to prevent and reduce smoking prevalence.

22. Snow White is a story about a princess who takes refuge in a cottage with seven dwarfs after her stepmother tries to harm her.

23. Si te gusta la comida picante, prueba el guacamole con jalapeño.

24. They do not eat meat.

25. Cancer can impact different organs and systems in the body, and some cancers can spread to other parts of the body.

26. Leukemia can be caused by genetic mutations or exposure to certain chemicals or radiation.

27. Auf Wiedersehen! - Goodbye!

28. Players move the puck by skating, passing, or shooting it towards the opposing team's net.

29. El nacimiento es un evento muy emocionante y significativo en la vida de una familia.

30. Namangha si Nicolas sa kanyang narinig sapagkat unang beses lang siyang nakarinig ng dalagang natutuwa sa mga palaka.

31. Forgiveness requires a willingness to let go of the desire for revenge or retribution and choose compassion instead.

32. Naging mayaman din ang mag-anak dahil sa mga bentang tela na ginagawa ng bata.

33. Cada nacimiento es un milagro y un regalo especial.

34. The scientific method involves forming hypotheses and testing them through experiments.

35. Nakiisa naman sa kanilang kagalakan ang mga kapitbahay.

36. Nagbigay ang albularyo ng anting-anting upang protektahan ang bata sa masasamang espiritu.

37. Emphasis can be used to highlight a person's strengths and abilities.

38. Frustration can also be caused by interpersonal conflicts or misunderstandings.

39. Inflation kann zu einer Abwertung der Währung führen.

40. Kailangan nating magtiyaga at magsumikap sa ating mga pangarap, datapapwat ay hindi ito agad-agad natutupad.

41. Sa pagkakaroon ng pagkakamali, hindi maiwasang maglabas ng malalim na himutok.

42. La paciencia es necesaria para tomar decisiones importantes.

43. Nakakabahala ang mga posibleng epekto ng kanilang plano kaya ako ay tumututol.

44. Balak po naming bumalik sa susunod na linggo.

45. Nakakamangha ang mga tanawin sa isla.

46. Agad niya itong kinuha at isinaboy sa paligid ng salamangkera.

47. Nagluto ako ng adobo para sa kanila.

48. Nakapila ako sa bayad center upang magbayad ng kuryente.

49. The restaurant has a variety of options on the menu, from vegetarian to meat dishes.

50. He has written a novel.

Similar Words

Compostelatelang

Recent Searches

napadaanturontelaidiomapulongsusiculpritexpresankasal1960sofrecenmakinangbumilipangkaticonssagapdefinitivotiningnanmagbigayancarbonmaidaksidentenakapaligidkapainiloilodaladalaailmentsbansangfrescotsakabingisupilinanaykaarawanwalngpiecesdreampinatidaywanbinigaysiyamapaibabawpangingimitryghedwalisulamimportantescriticsfurycongressmaitimshowsfansvideorhythmfireworkselectionpasangstevemuliperlapalayanmapakaliencounteradvancedborngracesumangipinagbilingkartonipongsimplengupworkstopandyrepresentedenforcingtelevisednothingnag-replypaaralanwindowinitbatalearningcomputerinaapikasingdumaraminakapagusapginugunitamaalognanlilisikkapangyarihangaanhinskills,pronounnabubuhaynag-uumiriyumuyukonareklamonagtataecommissioniostabilumiwanagnalugodkatutubotumaposliligawanbayadhinalungkatmemorialmagnakawkara-karakaminutoakmangmabigyanpisaragroceryadvertisingendvideretanawvarietybaguiotanongupuanwikaaregladolihimpeppycompositorespuwedemansanasbinataksumakaymadurasnakapuntanumerosaspostcarddollardyantooharaprenombrenakatunghaynagbanggaanpinakamaartengpagbabagong-anyonaglalatanglumiwagkarwahengcultivarmiyerkolesmusiciansasayawinkalakihannagtuturolumalakinananaginipmagpapagupitnapatakbokaharianmagagawakamakailankonsultasyonkarunungannaguguluhanbumisitapagpilirevolutioneretquecorporationmasarapnaglokolumamangfitnesskinasisindakanbeautygumawamalulungkotyumabangmagsasakapinapataposhiramtamarawnalangorkidyaspwedengpagongsementeryomahabolsinehanalagangtiyaknagsamaperpektingsiguradoregulering,skirt