Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

22 sentences found for "tela"

1. A medida que la tecnología avanzó, se desarrollaron nuevos tipos de teléfonos, como los teléfonos inalámbricos, los teléfonos móviles y los teléfonos inteligentes

2. Además, el teléfono ha sido una herramienta valiosa en la venta telefónica y en la realización de encuestas

3. Ang mag-asawa ay may hanapbuhay na paghahabi ng mga tela.

4. Ang pasya nang pagkapanalo ay sa tela ng matanda.

5. At habang lumalaki na nga ang bata ay unti-unti itong naging bihasa sa paghahabi ng mga tela.

6. Baka nga si Amba pa gumawa ng tela aniya.

7. El powerbank es una solución conveniente para cargar teléfonos móviles, tabletas u otros dispositivos en movimiento.

8. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

9. El teléfono es un dispositivo electrónico que permite la comunicación a distancia mediante el uso de señales de sonido

10. El teléfono también ha tenido un gran impacto en la forma en que las empresas se comunican con sus clientes

11. En resumen, el teléfono es un dispositivo electrónico que permite la comunicación a distancia mediante el uso de señales de sonido

12. Igigiit nito na ang matanda ay nandaya at baka ipinalit lamang ang isang nagawa nang tela sa ginagawa nito.

13. Kailangang salatin mo ang tela para malaman kung gaano ito kalambot.

14. La conexión a internet se puede hacer a través de una variedad de dispositivos, como computadoras, teléfonos inteligentes y tabletas.

15. Los powerbanks son populares entre los usuarios de teléfonos móviles y otros dispositivos electrónicos.

16. Los teléfonos inteligentes son una evolución de los teléfonos móviles y ofrecen aún más funciones y capacidades

17. Los teléfonos móviles también ofrecen una variedad de funciones adicionales, como la capacidad de enviar y recibir mensajes de texto, tomar fotos, acceder a internet y utilizar aplicaciones

18. Los teléfonos móviles, también conocidos como celulares, son probablemente los tipos de teléfonos más comunes en la actualidad

19. Muchas empresas utilizan números de teléfono de línea directa o números de call center para brindar soporte técnico o atención al cliente

20. Naging mayaman din ang mag-anak dahil sa mga bentang tela na ginagawa ng bata.

21. Sa anong tela gawa ang T-shirt?

22. Sa anong tela yari ang pantalon?

Random Sentences

1.

2. Nationalism has been used to justify imperialism and expansionism.

3. Les enseignants peuvent organiser des activités parascolaires pour favoriser la participation des élèves dans la vie scolaire.

4. Einstein's brain was preserved for scientific study after his death in 1955.

5.

6.

7. They have been volunteering at the shelter for a month.

8. Consumir una variedad de frutas y verduras es una forma fácil de mantener una dieta saludable.

9. Tumahol ang aso at natakot ang pusa.

10. The website's design is sleek and modern, making it visually appealing to users.

11. Dumating ang mga atleta sa entablado nang limahan.

12. Les écoles travaillent à fournir un environnement d'apprentissage sûr et inclusif pour tous les étudiants.

13. Las hojas de otoño son muy bonitas en la ciudad.

14. As a lender, you earn interest on the loans you make

15. Naglalakad siya sa parke araw-araw.

16. Bahagya na niyang maulinigan ang ina.

17. Pinili ng mga magulang ang pinakamalapit na paaralan sa kanilang tahanan upang hindi na mahirapan ang mga bata sa pagbiyahe patungong silid-aralan.

18. Nakarinig siya ng tawanan.

19. El powerbank utiliza una batería recargable para almacenar energía.

20. Mens gambling kan være sjovt og spændende, er det også vigtigt at huske på, at det kan have negative konsekvenser, hvis det ikke håndteres på en ansvarlig måde.

21. La perspectiva es una técnica importante para crear la ilusión de profundidad en la pintura.

22. Instagram also offers the option to send direct messages to other users, allowing for private conversations.

23. Burning bridges with your ex might feel good in the moment, but it can have negative consequences in the long run.

24. Las personas pobres a menudo tienen que trabajar en condiciones peligrosas y sin protección laboral.

25. Hang in there."

26. Ang takip-silim ay isang magandang panahon para mag-unwind at mag-isip-isip sa mga bagay-bagay.

27. Biglaan siyang nagsalita nang hindi ko inaasahan na magkakaroon siya ng ganung opinyon.

28. I know this project is difficult, but we have to keep working hard - no pain, no gain.

29. Revise and edit: After you have a complete draft, it's important to go back and revise your work

30.

31. Mababaw ang swimming pool sa hotel.

32. Ang resiliency ng mga Pinoy ay patunay ng kanilang lakas sa harap ng pagsubok.

33. Tumama ang kanan niyang pisngi sa labi ng nabiawang balde.

34. Ha?! Ano ba namang tanong yan! Wala noh!

35. Banyak pemilik kucing di Indonesia juga menjaga kebersihan kandang atau tempat tinggal kucing mereka.

36. A couple of raindrops fell on my face as I walked outside.

37. Sa probinsya, maraming tao ang naglalaba sa ilog o sa bukal.

38. Utiliza métodos orgánicos para combatirlas, como el uso de polvos de hierbas o infusiones

39. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

40. "Dogs are not our whole life, but they make our lives whole."

41. Nag-asaran, naglokohan at nagtawanan sila.

42. Naglaro sina Paul ng basketball.

43. Ang tissue ay mabilis higupin ang tubig.

44. Sa dakong huli ng deadline, nai-submit ko na rin ang aking project.

45. Si Anna ay maganda.

46. Palayo na nang palayo ang tunog ng kampana habang umuusad ang gabi.

47. Mababa ang sahod sa trabaho, kaya naghanap siya ng ibang mapagkakakitaan.

48. The students admired their teacher's passion for teaching and learning.

49. Effective communication and problem-solving skills can help prevent or resolve situations that lead to frustration.

50. Conservation efforts, such as protecting natural habitats and endangered species, are critical to maintaining a healthy environment.

Similar Words

Compostelatelang

Recent Searches

telaabigaellunesinimbitabalatmayamangcarlonilolokonanaylaranganpromotechooseiconic1954makahingikumatoksarakombinationnataposstep-by-stepfonosreachtapatbeginningssipaindiaasoalaalajapanaralisipsubalitsangtainga11pmkabosesgumuhitlendingeducativasboksingmurang-murabangamisacryptocurrencymemomallaywaneliteaminsinunodarawtaglagaslibonewmuchashumanosjerrythenaalislatejackzguardanilapitanbulalasairconoverviewstagesulingannamepressngpuntaatapasanfansnapilinginformedcurrentmainstreameasysquatterbakebehalfboyginamagkabilangisinawakhinding-hindisimbahatelevisedfluidityeconomicmag-asawangundeniableibigabaevnepangetpandemyaclockkumirotdisfrutarlayuankinagagalaknagdalamataaasmatayogkikitalalakenagpasannangyarisabongmabaitilangnaggingitinuringsobratilibabatataasmabihisaniilanandrewtaga-hiroshimakamotekwartocoaching:amoiguhitmaghahatidkidkiranpananglawbumababanakikitanghelpfuldiseaseswastetungawkayang-kayangdibarobertipinangangakchambersmalalakinagmungkahipasasalamatpostcardipinatawagmalagoeksammapahamakabut-abotberegningerpagpapakilalamatandang-matandamapakalicontrolledsandalingnagsisipag-uwianflyvemaskinererlindapagkakayakapedukasyonvitamincuandopinakamagalingmayastopnyannapakasipagpamburalilipadlumilipadrhythmtotoongnakapagreklamoressourcernecommerceclassessinagotnakadapasalubongpaladisinuotmariemakabilidelehetonagtaposbrancher,magta-trabahopilingbiocombustiblesnamumutlataga-ochandotextoadopteddiferentesteknologihumahangoskabuntisan