Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

3 sentences found for "items"

1. Facebook Marketplace is a platform where users can buy and sell items locally.

2. Its cultivation on a wide scale with the help of negro-slaves made it one of the major export items in the American economy

3. Lazada has launched a grocery delivery service called LazMart, which delivers fresh produce and household items to customers.

Random Sentences

1. The company had to cut costs, and therefore several employees were let go.

2. Magandang maganda ang Pilipinas.

3. Marahil ay mas mahal ang presyo ng gulay ngayon kumpara sa nakaraang buwan.

4. The victim was able to identify the culprit who had been harassing them for months.

5. Hindi dapat natin ipagwalang-bahala ang mga babala at paalala ng mga eksperto, samakatuwid.

6. The elephant in the room is the fact that we're not meeting our sales targets, and we need to figure out why.

7. Ang hinagpis ng buong bansa ay naging lakas upang magkaisa sa harap ng pagsubok.

8. Limitations can be a result of fear or lack of confidence.

9. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

10. Sandali na lang.

11. Ein frohes neues Jahr! - Happy New Year!

12. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

13. Natutuwa ako sa balitang iyan mahal ko.

14. Paborito ko kasi ang mga iyon.

15. Agad na kumalat ang balita na may dala si Ana na pagkain, kaya sumugod sila sa bahay ni Aling Rosa.

16. Ibinigay ni Ana ang susi kay Sally.

17. Sayur asem adalah sup sayuran dengan bumbu yang asam dan pedas.

18. Los juegos de mesa son un pasatiempo divertido para jugar en familia o con amigos.

19. Hospitalization can be expensive, and patients may be responsible for paying for medical bills and other associated costs.

20. Reden ist Silber, Schweigen ist Gold.

21. Durante las vacaciones de Semana Santa, asistimos a procesiones religiosas.

22. Ang mga anak-pawis ay nagtatrabaho sa iba't ibang sektor ng ekonomiya, tulad ng agrikultura at pagmimina.

23. Tinignan nya ilan sa mga ginawa ko, Okay na yan.

24. It's complicated. sagot niya.

25. His presidency was marked by controversy and a polarizing political climate.

26. Durante el trabajo de parto, las contracciones uterinas se hacen más fuertes y regulares para ayudar al bebé a salir.

27. He has been gardening for hours.

28. Nagdulot ng kakulangan sa tubig ang matagal na tagtuyot sa kanilang lugar.

29. Umuuwi siya sa probinsiya linggo-linggo.

30. Naupo siya sa sofa at inilagay yung bitbit niya sa mesa.

31. Ang alon sa karagatan ay malakas ngayon dahil sa bagyong dumaan.

32. Sweet foods are often associated with desserts, such as cakes and pastries.

33. "Love me, love my dog."

34. Nakatuwaang kainin ng mga bata ang bunga.

35. Sa bawat salaysay ng nakaligtas, maririnig ang kanilang hinagpis sa trahedya.

36. Money can be a source of stress and anxiety for some people, particularly those struggling with financial difficulties.

37. Ano ang pangalan ng babaeng buntis?

38. Si Jose ay na-suway sa simpleng paalala na huwag mangulangot sa harap ng ibang tao.

39. Electric cars are environmentally friendly as they emit no tailpipe pollutants and produce zero greenhouse gas emissions.

40. Paglabas niya ng bahay, nabigla siya nang biglang umambon ng malakas.

41. The sunset view from the beach was absolutely breathtaking.

42. Kaninong payong ang asul na payong?

43. Bumili si Ana ng lapis sa tindahan.

44. Las heridas en la cara o cerca de los ojos deben ser evaluadas y tratadas por un especialista en oftalmología.

45. Sayang, jangan khawatir, aku selalu di sini untukmu. (Don't worry, dear, I'm always here for you.)

46. I didn't want my sister to know about the family vacation, but my mom let the cat out of the bag by accident.

47. Hay muchos riesgos asociados con el uso de las redes sociales, como el acoso cibernético.

48. Malapit na naman ang eleksyon.

49. Time management skills are important for balancing work responsibilities and personal life.

50. The legislative branch, represented by the US

Recent Searches

existitemsdoinginteractpersistent,increasespointmerenicenasundoipapahingaupworkpetertagaytaytindakumalatbalecosechar,writing,napakakasiyahanpwedengnabasaindependentlypagpalitnaiinitanpelikulaiigibpopcornlayasanifuepartymagsasakatrabajarsilid-aralancontestbarnesnagtatakbocryptocurrency:reloritwalelectionsorederubonanonoodgapmediumconvertingarawprogramshatesourceculturasmagdamagtaga-ochandomamahalinpagbigyanenviarmagsunoghurtigerenag-emailhumalokolehiyoiniindatumatawaboyetbinabalikagalaborfeedback,systematiskexamsukatomeletteelitebangiskosinapakdiamonddevelopmentprogressninacomputerformsworkshoprepresentativelasingquicklyskillpracticesinspiredtechnologiesservicespinag-usapanginugunitakalalakihanbarung-barongmakikitakomunikasyonkinakitaanbiocombustiblesinvesting:magpapagupitnakapasokinvestingbalitapaglisanpronounisulatmatalinotreatsnagnakawtagtuyothelpfulaminnakakasamapakanta-kantangnagtatampomagpapabunotpresidentialnakakapasokpaki-translatemagnakawmagtatagalpagpapatubomakauuwipag-aaralsabadkatagalanumiiyakpagkahapoaanhinnakapaligidlumiwanagmakahiramkaloobangnagpipiknikbibisitamagkaibatravelerkaswapanganhardinkamakailantatagalmaipagmamalakingmahuhusayutak-biyayumabongnaabutannapanoodnagmadalingtumutubonakuhapagtutolnakatuloginakalaapatnapumakauwilabinsiyamnasasalinannakahugnaglulutopioneerkidkiranpaki-chargebagsakibinibigaynalalabingmaghihintaykatolisismonaglutonagsilapitmasaganangmasaktanbumaligtadpinalalayasregulering,nagbabalaprincipaleskagubatanmangyariharapankomunidadchristmasmaaksidentenahantadumulannangingisaysakennauntogbihiratumindigsumasayawhalinglingligayasignaliyamotnagdiriwang