Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

13 sentences found for "strength"

1. All these years, I have been inspired by the resilience and strength of those around me.

2. Aquaman has superhuman strength and the ability to communicate with marine life.

3. Black Panther is the king of Wakanda and possesses enhanced strength, agility, and a suit made of vibranium.

4. Captain America is a super-soldier with enhanced strength and a shield made of vibranium.

5. He was also a pioneer in the use of strength and conditioning techniques to improve martial arts performance

6. Hockey requires a combination of physical and mental skills, including speed, agility, strength, and strategic thinking.

7. Hulk is a massive green brute with immense strength, increasing his power the angrier he gets.

8. It takes strength and courage to offer forgiveness, especially when the hurt is deep.

9. Shaquille O'Neal was a dominant center known for his size and strength.

10. Supergirl, like Superman, has the ability to fly and possesses superhuman strength.

11. Superman possesses incredible strength and the ability to fly.

12. Thor possesses god-like strength and wields a powerful hammer called Mjolnir.

13. Women have shown remarkable resilience and strength in the face of adversity and oppression.

Random Sentences

1. Hinanap ko ang pulotgata sa bukid upang magkaroon ng panghimagas.

2. They travel to different countries for vacation.

3. El primer llanto del bebé es un hermoso sonido que indica vida y salud.

4. Mengatasi tantangan hidup membutuhkan ketekunan, ketabahan, dan keyakinan pada kemampuan kita sendiri.

5. May tatlong kuwarto ang bahay namin.

6. Kulay itim ang libro ng kaklase ko.

7. Nagsusulat ako ng mga liham ng aplikasyon upang mag-apply sa trabaho o scholarship.

8. En la realidad, hay muchas perspectivas diferentes de un mismo tema.

9. Nahintakutan ang lahat at hindi magawang lumaban sa magbabagsik na tulisang-dagat.

10. Viruses are small, infectious agents that can infect cells and cause diseases.

11. The company decided to avoid the risky venture and focus on safer options.

12. From there it spread to different other countries of the world

13. The weatherman said it would be a light shower, but it's definitely more like it's raining cats and dogs.

14. All these years, I have been striving to be the best version of myself.

15. Nakikita si Carlos Yulo bilang inspirasyon ng maraming kabataang Filipino.

16. His invention was an improvement over earlier attempts to create a long-distance communication device, such as the telegraph, which could only transmit messages in Morse code

17. Ano ang kinakain niya sa tanghalian?

18. Some couples choose to have a destination wedding in a different country or location.

19. Maganda ang bansang Japan.

20. The team's performance was absolutely outstanding.

21. Nakatira si Nerissa sa Long Island.

22. Eating a balanced diet can increase energy levels and improve mood.

23. Madilim ang paligid kaya kinailangan niyang salatin ang daan pabalik.

24. Sa bawat pagkakataon na pinagmamalupitan ako, lumalaki ang poot sa aking puso.

25. The hospital had a special isolation ward for patients with pneumonia.

26. Nagpaluto ang nanay ko ng adobo sa akin.

27. Les systèmes de recommandation d'intelligence artificielle peuvent aider à recommander des produits et des services aux clients.

28. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

29. Laking galak nito nang matagpuan ang maraming itlog ng bayawak, at tuwang-tuwa na tinirador ang mga itlog.

30. At sana nama'y makikinig ka.

31. Las redes sociales son una parte importante de nuestras vidas hoy en día.

32. Tahimik na nanangis si Aling Rosa at laking pagsisisi dahil tumalab ang kanyang sinabi sa anak.

33. Hendes måde at tænke på er fascinerende og udfordrer mine egne tanker. (Her way of thinking is fascinating and challenges my own thoughts.)

34. Ayaw ko ng masyadong maanghang/matamis.

35. Gusto ko ang malamig na panahon.

36. Hindi siya nakapagpahinga ng maayos kagabi, samakatuwid, inaantok siya ngayon sa klase.

37. Nakatayo ang lalaking nakapayong.

38. Tinangka umano ng pulis na kausapin ang mga nagpoprotesta bago sila buwagin.

39. Pour maintenir sa motivation, il est important d'avoir des objectifs clairs et réalisables.

40. Ang kalayaan ay nagbibigay sa atin ng kakayahang magpasya at magplano para sa ating sariling kinabukasan.

41. Limitations can be a result of geographic location or access to resources and opportunities.

42. Ang digmaan ay maaaring magdulot ng pagbabago sa pamamahala ng isang bansa.

43. Risk tolerance is an important factor to consider when deciding how to invest.

44. Limitations can be overcome through perseverance, determination, and resourcefulness.

45. Ang sugal ay maaaring magdulot ng pagsisira sa relasyon at pamilyang pinansyal.

46. Mens online gambling kan være bekvemt, er det også vigtigt at være opmærksom på de risici, der er involveret, såsom snyd og identitetstyveri.

47. However, it is important to note that excessive coffee consumption can also have negative health effects, such as increasing the risk of heart disease.

48.

49. Nang makita ng mga kababayan niya ang bunga naghinala silang naroon sa punong iyon ang kanilang gong.

50. Miguel Ángel fue un maestro de la técnica de la escultura en mármol.

Recent Searches

strengthpressplayshardwalletmakisigbelievedpaghihingalopaasumapitspeedemphasishoweversisipainsamachamberspalagaytiyakinatatakutannaglinisreserbasyonbugbuginmagtatagaldahan-dahanmalayangprimerashiganagpagupitpagdudugotumakasrebokumalantoghapag-kainantapatnaglalakadgamitkitkumidlatkagubatannaghandatiposbowlmakapagempakerailengkantadakanserisinamaaksidenteestateinilingpinunitinulitkingdomconnectingdollymarahanhumanomallbaleoftedyanparatingmatabadumaramiamazonsolidifyumagalawaypagpapasannaiilaganakotemparaturateleponoresourceskumbentobayanritolasnilolokomagbibiyahemakapagpigilpictureskampeonbyggetmensajesbangisasamapinansinpatientkamaliankatapatngisikalyeparoroonanganglangitbintananahihilokindsdinukotdaladalakalupihydelnagpuntashowsfigurenerissaleukemiacafeteriabinilingbabekinapanayamhighestnakapagngangalitkategori,nagtungomagpalibrekabuntisannagawanginakalangliv,nangangaralnahuhumalingkarunungankaninumannakahugistasyontumiratumalimmateryalespagkaangatlinggongkagipitane-bookspagbebentahouseholdinuulampoongpeksmanjingjingtungomakilalaamuyinsinoiikutantelecomunicacioneskesoeksempelanumangdurantedireksyonbalikattienenika-50garbansosnaguusapinlovedifferentumupoconvey,musicalkuligligdisensyoproblematsonggoreorganizingtumingalahinukaypagsidlansahodhanapinbarcelonanakainpneumoniaeroplanonayondisenyopagpasokidiomanatayokayoahhhhnakabiladmayroongkatagalanalasmasipagkasalatensyonkasamamadalingdyipmagisingpasalamatanilocosstockskasaysayanmatabangbigongambag