Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "nagkasunog"

1. Ano ang ginagawa mo nang nagkasunog?

Random Sentences

1. Gusto mo ba ng isa pang tasa ng kape?

2. Known for its sunny weather, Los Angeles enjoys a Mediterranean climate throughout the year.

3. I like how the website has a blog section where users can read about various topics.

4. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

5. Kevin Durant is a prolific scorer and has won multiple scoring titles.

6. En ren samvittighed kan give os en følelse af ro og tilfredshed.

7. Ang aking Maestra ay napakabait.

8. Bakit nga ba niya papansinin si Ogor?

9. Drømme kan være små eller store, men alle er vigtige.

10. Kinuha naman nya yung isang bote dun sa lamesa kaso.

11. Electric cars can help reduce air pollution in urban areas, which can have positive impacts on public health.

12. His first hit, That's All Right, was released in 1954 and quickly climbed the charts

13. Women have been elected to political office in increasing numbers in recent years, though still underrepresented in many countries.

14. Det er vigtigt at huske, at helte også er mennesker med fejl og mangler.

15. The value of a true friend is immeasurable.

16. Les écoles offrent des bourses pour aider les étudiants à payer leurs frais de scolarité.

17. The culprit behind the cyberattack on the company's servers was traced back to a foreign country.

18. Ang mga medical technologist nagsisilbi upang magbigay ng tumpak na resulta sa mga laboratory tests.

19. La pobreza afecta no solo a las personas, sino también a las comunidades enteras.

20. Lumitaw ang kagandahan ni Marie matapos syang mabihisan.

21. Bumili ka ng blusa sa Liberty Mall.

22. Ang mga batikang mang-aawit at musikero ay karaniwang itinuturing bilang mga alamat sa larangan ng musika.

23. Les algorithmes d'intelligence artificielle peuvent être utilisés pour optimiser la consommation d'énergie dans les bâtiments.

24. Yey! Thank you Jacky! The best ka talaga!

25. Being aware of our own emotions and recognizing when we are becoming frustrated can help us manage it better.

26. El cultivo de hortalizas es fundamental para una alimentación saludable.

27. Grande is renowned for her four-octave vocal range, often compared to Mariah Carey.

28.

29. Saan-saan kayo lumibot sa Amerika?

30. Ang talambuhay ni Apolinario Mabini ay nagpapakita ng kanyang talino at dedikasyon sa paglilingkod sa bayan.

31. Sa aking kasintahan, natatanaw ko ang pagmamahal na umaapaw sa kanyang mga mata.

32. Twitter has become an integral part of online culture, shaping conversations, sharing opinions, and connecting people across the globe.

33. The athlete completed a series of intense workouts to prepare for the competition.

34. ¿Dónde vives?

35. Puwedeng hiramin mo ang aking laptop habang inaayos ang iyong sarili?

36. No pierdas la paciencia.

37. Isinilang si Apolinario Mabini noong ika-23 ng Hulyo, 1864.

38. **You've got one text message**

39. H-hindi na sabi eh! inis na sabi nya.

40. Muchos agricultores se han visto afectados por los cambios en el clima y el medio ambiente.

41. Ang sugal ay isang pampalipas-oras na aktibidad na may kaakibat na panganib ng pagkakabigong pinansyal.

42. Cheating can have devastating consequences on a relationship, causing trust issues and emotional pain.

43. Nosotros nos disfrazamos y vamos a fiestas de Halloween durante las vacaciones.

44. Kumikinig ang kanyang ulo at nangangalit ang kanyang ngipin.

45. Nagkantahan kami sa karaoke bar.

46. Nareklamo ko na ho ito pero wala hong sagot.

47. Naghahanap ako ng kailangang gamitin at hinugot ko mula sa baul ang mga ito.

48. Brad Pitt is known for his charismatic performances in movies such as "Fight Club" and "Ocean's Eleven."

49. Min erfaring har lært mig, at det er vigtigt at have en god arbejdsetik.

50. Sino ang kasama ng ate mong naglakad kahapon?

Recent Searches

minutoentryexpertisenagkasunogtumamaibonpalengkesarilicomunicarseniyanhila-agawaninilistaknightcheckspakikipagbabaglumitawmagalingkamaliandadalodapit-hapontrentanakaangatsanayginagawatopicpagkaawagoalphilippinelungsodilalagaypaglisannakapagtatanongkinatatalungkuangpinagalitantiniokuwartorenombrekagandahagnamulaklakt-shirtkatandaannakatirangtelefonpinapalomembersfollowingactualidadanumangmalasutlanaliligoexperience,kenjisabihindemocraticputigandahanresumenkwenta-kwentalarongheikalayuanmapaibabawbulakbinibilanganilawalkie-talkiemaisusuothinukaydettumatawagmagandangbahagyapagpapautanghimihiyawturonnagwelgatumugtogmagdaannag-isipforståsakyankalalakihantangeksmaramottagpiangstoretrafficalas-diyesshowmagbabagsikomeletteika-12walismaglalakadritocoatbansangmaghintayparaangpinaulananpagkasabikinabubuhaynamungamagpahabasumasayawmarurusingbritishbinatilyogusting-gustokamandagskyinisipproducerermeriendapahahanapelectedvedvarendejocelynlaginabubuhaysalatnilutotabainferiorestoolkutodnagplaydiyaryotravelcomunespalagimakikipag-duetoritwalbigongbinigyangbabavampiresskyldesthemhusokumakantanalugoddaratingnaghuhumindiglumayoartificialbituinstructurereleaseddifferentleftpagpasensyahanwhysatisfactioncomputerdilimbilibidsakopincreasesspeechhugispointoperahanpaslitsamakatwidpaakyatsinampalnapipilitanmagpuntapaghingixviiniligawanrolledlasonkapagkayaanakkinuhatanghalilottotatawagculpritninaheyipagpalitebidensyapinakamahabamangpedetuladdumukottakeskasinggandalarawandedicationpare-parehosakingatolbilib