Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

23 sentences found for "dedication,"

1. Achieving fitness goals requires dedication to regular exercise and a healthy lifestyle.

2. Athletes who achieve remarkable feats often credit their success to their unwavering dedication and training regimen.

3. Dedication is the commitment and perseverance towards achieving a goal or purpose.

4. Dedication is the driving force behind artists who spend countless hours honing their craft.

5. Dedication is the fuel that keeps us motivated, focused, and committed to achieving our aspirations.

6. Dedication is what separates those who dream from those who turn their dreams into reality.

7. Dedication to a cause can mobilize communities, create social change, and make a difference in the world.

8. Dedication to environmental conservation involves taking actions to protect and preserve our planet for future generations.

9. Dedication to personal growth involves continuous learning and self-improvement.

10. Grande's dedication to her artistry and philanthropy continues to inspire fans worldwide.

11. He is also remembered for his incredible martial arts skills, his charismatic stage presence, and his dedication to personal development

12. I admire my mother for her selflessness and dedication to our family.

13. Olympic athletes demonstrate incredible dedication through years of rigorous training and sacrifice.

14. Overcoming challenges requires dedication, resilience, and a never-give-up attitude.

15. Successful entrepreneurs attribute their achievements to hard work, passion, and unwavering dedication.

16. The dedication of healthcare professionals is evident in their tireless efforts to provide care and save lives.

17. The dedication of mentors and role models can positively influence and shape the lives of others.

18. The dedication of parents is evident in the love and care they provide for their children.

19. The dedication of scientists and researchers leads to groundbreaking discoveries and advancements in various fields.

20. The dedication of volunteers plays a crucial role in supporting charitable causes and making a positive impact in communities.

21. We admire the dedication of healthcare workers in the midst of the pandemic.

22. With dedication, patience, and perseverance, you can turn your manuscript into a finished book that you can be proud of

23. Writing a book is a long process and requires a lot of dedication and hard work

Random Sentences

1. Sampai jumpa nanti. - See you later.

2. Hindi mo na kailangan humanap ng iba.

3. It's hard to break into a new social group if you don't share any common interests - birds of the same feather flock together, after all.

4. O sige, ilan pusa nyo sa bahay?

5. It has revolutionized the way we communicate and has played a crucial role in shaping modern society

6. Pagod na ako, ayaw ko nang maglakad.

7. Ang tagumpay ng kanilang proyekto ay lubos na ikinagagalak ng kanilang grupo.

8. She does not smoke cigarettes.

9. Nakakapagtaka naman na hindi nya ito nakita.

10. Sa mga hayop, ang hudyat ay maaaring gamitin sa pakikipag-ugnayan, tulad ng pagpapakita ng kilos ng buntot o ng mata.

11. Utak biya ang tawag sa mahina ang pag iisip

12. Nagpakitang-gilas si Jose sa pamamagitan ng mabilis na pagpasa ng bola.

13. Sueño con tener mi propia casa en un lugar tranquilo. (I dream of having my own house in a peaceful place.)

14. D'you know what time it might be?

15. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

16. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

17. Nagbabaga ang araw sa gitna ng tanghali, dahilan upang mabilis na matuyo ang mga damit.

18. Ganoon ng ganoon ang nangyayari.

19. Sweetness is a sensation associated with the taste of sugar and other natural and artificial sweeteners.

20. Ang pagtitiyak ng seguridad sa mga border at mga pantalan ay mahalaga upang maiwasan ang pagpasok ng mga illegal na droga sa bansa.

21. Bumibili si Rico ng pantalon sa mall.

22. Omelettes can be seasoned with salt, pepper, and other spices according to taste.

23. The damage done to the environment by human activity is immeasurable.

24. Dedication to a cause can mobilize communities, create social change, and make a difference in the world.

25. Les maladies infectieuses telles que le VIH/SIDA, la tuberculose et la grippe peuvent être prévenues grâce à une bonne hygiène et des vaccinations.

26. Ang paglutas ng mga palaisipan ay nakakatulong sa pagpapalawak ng kaalaman at kakayahan sa pagpapasya.

27. I am working on a project for work.

28. Kasama ko ang aking mga magulang sa pamanhikan.

29. Nasa harap ng tindahan ng prutas

30. Pinatay na ng mga Alitaptap ang parol nila.

31. Pinayuhan sila ng albularyo na magdasal bago mag-umpisa ang gamutan.

32. The dancers are not rehearsing for their performance tonight.

33. She is designing a new website.

34. Nakatulog ako sa harap ng telebisyon at nagitla ako nang biglang nagtaas ang boses ng mga artista sa palabas.

35. Gusto ko sana na malaman mo na pwede ba kitang mahalin?

36. Work-life balance is important for maintaining overall health and wellbeing.

37. Kilala si Hidilyn Diaz sa kanyang malakas na paninindigan para sa mga kababaihan at atletang Pilipino.

38. Ketika menghadapi tantangan hidup, penting untuk menjaga keseimbangan antara kerja keras dan istirahat yang cukup.

39. Ang mga NGO ay nag-aapuhap ng donasyon upang matulungan ang mga batang ulila.

40. Nagitla ako nang biglang may lumabas na ahas mula sa mga halamanan.

41. Jagiya? hinde parin siya umiimik, Ya Kenji.

42. Sa panahon ng tag-ulan, mahalaga ang mga punong-kahoy dahil nakakatulong ito sa pagpigil ng pagbaha sa mga lugar na may malalaking bundok.

43. He has visited his grandparents twice this year.

44. Hashtags (#) are used on Twitter to categorize and discover tweets on specific topics.

45. Ilan po ang lalaking pumasok sa restawan?

46. Magbantay tayo sa bawat sulok ng ating bayan.

47. A couple of friends are coming over for dinner tonight.

48. Nogle helte går frivilligt ind i farlige situationer for at redde andre.

49. All these years, I have been overcoming challenges and obstacles to reach my goals.

50. Hinahanap ko si John.

Recent Searches

lordpalasyodedication,natalongiwinasiwasrolandiskobateryabosstinanggappaglalabadadiscipliner,maidnagsmileconstitutionkwartopaligsahanilangtinanggaldropshipping,sanpinisilpakibigayiwasiwaseyekamabatitopic,ipinangangakkagandahanpartyniyonpalancahinawakan1950sbisitanahawakanmabibinginakonsiyensyamansanasbridegumagamitwikapundidoinangpambatangwatchmagkaibigankaaya-ayangburgerbumigaysino-sinosinoeuropepwestotuwidbumilieksayted4thcollectionsemocionalpublishing,artistsmaasahanfiguresinkengkantadangjagiyanilayuanlipatparusahankumbentoginagawasurveyspesostumahantuktokpagbatikitpisaragrewdollarpitumpongumingitmakaangalplatformsyumuyukotonightgandawasaknamumulanalugodnahihilopitongisisinusuklalyantumaposfulfillingkalamansikalavetocomputereagwadorbarangayarguenagpuntapakelampaksapuedensumusunoaywanatingpinakidalanapagodlikelyinagaweditorabalamagta-taxibulagmagsi-skiingwalletprosesoeeeehhhhpalayanprovidednanghahapdikasinggandapaalampwedenglayuninmagsusunuranmahahabapusaistasyonclockmakaratingsistemaslarryoperativossiguropanginoonuntimelybaguioumigibitinulosfreelancertumindigtanghalicomuneslaruinbumangonmagagandadiversidadmendiolangunitmakasamasipapasinghalbio-gas-developingadditionallykirbysambitincitamentermanagernerissanamumulottatlongkasingkinausapkoronanamanghamaglutonaglakadipinadalapresence,umuusigmagtiislagunakalakihanneed,binibiyayaankinalilibinganpinagsikapanmasokkaypointnapupuntakausapincandidaterenetabassamakatwidnatatakotisuotmakakatakaspagkuwascottishginawangmaghugas