Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

6 sentences found for "forms"

1. Cheating can occur in many forms, including physical infidelity, emotional infidelity, or both.

2. Hockey is known for its physicality, with players often engaging in body checks and other forms of contact during the game.

3. It has changed the way that people consume media, it has created new forms of entertainment, and it has played an important role in politics, education, and advertising

4. Money can take many forms, including cash, bank deposits, and digital currencies.

5. People can also borrow money through loans, credit cards, and other forms of debt.

6. The invention of the motion picture camera and the development of television and video games have provided new forms of entertainment for people of all ages

Random Sentences

1. It can be awkward to meet someone for the first time, so I try to find common ground to break the ice.

2. She exercises at home.

3. Nagtalaga sila ng mga dibisyon kung saan maninirahan ang bawat hayop.

4. Las redes sociales tienen un impacto en la forma en que las personas se comunican y relacionan.

5. Paki-bukas ang bintana kasi mainit.

6. Ano ang tunay niyang pangalan?

7. The United States has a complex and diverse food culture, with regional specialties and international cuisine.

8. Las heridas que no sanan o empeoran con el tiempo pueden ser signo de una enfermedad subyacente y deben ser evaluadas por un médico.

9. Nationalism can also lead to a sense of resentment and hostility towards outsiders.

10. Madalas mapagalitan si Jake dahil sa pagiging malilimutin niya sa trabaho.

11. Laughter is the best medicine.

12. Ang aking kaibuturan ay nababagabag sa mga pangyayari sa mundo ngayon.

13. Ang saya saya niya ngayon, diba?

14. Ang haba ng prusisyon.

15. Para darle sabor a un guiso, puedes añadir una ramita de hierbas de tu elección.

16. Ilang termino na syang nagsisilbi bilang mayor ng kanilang lungsod.

17. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

18. Nang malapit nang magdilim, kumaripas na ang mga magsasaka pauwi sa kanilang tahanan.

19. Ang kabanata ay nagbigay ng mahahalagang detalye tungkol sa nakaraan ng pangunahing tauhan.

20. I have started a new hobby.

21. Nagtayo kami ng aming tindahan, bagkus hindi pa ito gaanong kilala ng mga tao sa lugar namin.

22. Sa dapit-hapon, masarap mag-meditate at mag-isip-isip sa mga bagay-bagay.

23. Hindi ako sang-ayon sa mga pahayag ng ilang mga personalidad sa social media.

24. Ano ka ba Beast! Bumitaw ka nga, ang daming tao oh.

25. Les hôpitaux sont des lieux où les patients peuvent recevoir des soins spécialisés.

26. Pakibigay sa driver ang bayad ko sa pamasahe, wala akong abot.

27. Igigiit nito na ang matanda ay nandaya at baka ipinalit lamang ang isang nagawa nang tela sa ginagawa nito.

28. Sa tuwing nakikita kita, nadarama ko na may gusto ako sa iyo.

29. Wala ho akong kinukuha sa inyong pitaka.

30. Mucho gusto, mi nombre es Julianne

31. El cultivo hidropónico permite el crecimiento de plantas sin utilizar suelo.

32. Jeg kan godt lide at skynde mig om morgenen, så jeg har mere tid til at slappe af senere på dagen. (I like to hurry in the morning, so I have more time to relax later in the day.)

33. Ang paglapastangan sa mga kagamitan at ari-arian ng iba ay isang paglabag sa mga prinsipyong moral.

34. Busy sa paglalaba si Aling Maria.

35. The weather forecast said it would rain, but I didn't expect it to be raining cats and dogs like this.

36. Mainit sa Pilipinas sa buwan ng Abril.

37. Ito'y hugis-ulo ng tao at napapalibutan ng mata.

38. I have lost my phone again.

39. In recent years, television technology has continued to evolve and improve

40. El invierno comienza el 21 de diciembre en el hemisferio norte y el 21 de junio en el hemisferio sur.

41. The field of entertainment has also been greatly impacted by technology

42. Muchas empresas utilizan números de teléfono de línea directa o números de call center para brindar soporte técnico o atención al cliente

43. Las escuelas también ofrecen programas de apoyo, como tutorías y asesoramiento académico.

44. Here are a few ideas to get you started: Freelancing: If you have a skill that others need, such as writing, graphic design, or programming, you can offer your services as a freelancer

45. Ang daming pulubi sa Luneta.

46. Pinatay na ng mga Alitaptap ang parol nila.

47. She always submits her assignments early because she knows the early bird gets the worm.

48. Nagpunta ako sa Hawaii.

49. We have been cleaning the house for three hours.

50. Pinoy ang nag-imbento ng jeepney na tinatawag ding “Hari ng Kalsada.”

Similar Words

platforms

Recent Searches

makeformssetswindoweffectprogramming,firstcommercepangakopinagmamasdanpartsbandakulangsuotmaingatpumuntahundredmapuputitumababiggestnakiisapamilyangfriesiyannanaogdidimikkadalasnasundorepresentedtaksilagnatiginitgitmatitigasmakikiraanincludeshowmaasimtonighttabing-dagatpagkakatuwaannagpapaniwalanagliliwanagnamumukod-tangibaku-bakongmatulunginnagpatuloynakapagsabinabalitaanmagasawanggobernadorpodcasts,madeikinakagalitkonsentrasyonginugunitanagagandahanhinimas-himasnageespadahanpronounnegro-slavestuluyanaanhinalas-diyesminu-minutomakalipasmakidalonaglakadkanomeletteipagpalitnagpadalanapadaanpagsahodkagipitanlumakasnagtalagatatagalpalaisipansagasaanairporthimihiyawnalugmokcigaretteamericaumiyaktennistv-showstotoongvideosmagpasalamatpagsubokkamandagumiimikweddingsasakaymasayamasaganangbayadcombatirlas,pagdiriwangnagyayanghinihintaygospelnatatawacualquiercountrydiyannagsilapitkapwasandwichmakisuyosunud-sunodgovernorssementonghinalungkatliligawanbighaninaghubadmakilalaasahanabigaelmaramotmaawaingpalayogroceryparaangbarcelonauniversitiesberetipagpalitnakuhadadalokutsilyoomfattendediseasemamarilhuertoabutanexperience,planning,bumangoninfluencesangheldespuesnilolokotugonwinsmataasarkilakumbentoipinamilinagsisilbibritishbinatakbumabagilawmakahingicoaltamabuhaymaistorbokumatokmagbigayankalakinggamitinailmentssigebuenaapoymalayanghaysayfilmsstopaskousoanimoykainblazingvehicles00amproductionsuccessfulredigeringmrspakpakmuchasreservedtenclasesdawcommunitydagaconvertidasroonstarputinatatanawpublished