Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

6 sentences found for "forms"

1. Cheating can occur in many forms, including physical infidelity, emotional infidelity, or both.

2. Hockey is known for its physicality, with players often engaging in body checks and other forms of contact during the game.

3. It has changed the way that people consume media, it has created new forms of entertainment, and it has played an important role in politics, education, and advertising

4. Money can take many forms, including cash, bank deposits, and digital currencies.

5. People can also borrow money through loans, credit cards, and other forms of debt.

6. The invention of the motion picture camera and the development of television and video games have provided new forms of entertainment for people of all ages

Random Sentences

1. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

2. La falta de vivienda adecuada y segura es un problema común para las personas pobres.

3. Fødslen kan være en tid med stor stress og angst, især hvis der er komplikationer.

4. Ang aso ni Lito ay mataba.

5. Nilagdaan niya ang kasunduan sa Biak-na-Bato noong 1897 para sa pansamantalang kapayapaan.

6. Disente tignan ang kulay puti.

7. Some Christians participate in fasting, prayer, and other spiritual practices during Holy Week as a way of deepening their faith and connection to God.

8.

9. The disagreement between them turned out to be a storm in a teacup.

10. "May sorpresa ako para sa’yo," ani ng tatay sa kanyang anak.

11. Dahil sa sarap ng lasa, nahuhumaling ako sa pagkain ng mga matatamis na pagkain.

12. Today, mobile phones have become an essential part of everyday life, and they have greatly expanded the capabilities of the telephone

13. Ang mga kawani sa serbisyo-publiko ay dapat na itinuring bilang mga tagapaglingkod ng bayan.

14. The treatment for leukemia typically involves chemotherapy and sometimes radiation therapy or stem cell transplant.

15. Fødslen kan føre til forskellige fysiske forandringer i kroppen, og genopretningstiden varierer fra person til person.

16. Les personnes âgées peuvent avoir des relations intergénérationnelles enrichissantes avec leurs petits-enfants.

17. Air susu dibalas air tuba.

18. Kinakailangan niyang magpakatatag kahit na nag-iisa siya sa laban.

19. The telephone has also played an important role in politics, as it has made it possible for leaders to communicate quickly and easily

20. Disculpe; ¿me puede ayudar por favor?

21. Nagsusulat ako ng mga kasunduan at kontrata bilang abugado.

22. Maarte siya sa pagpili ng kanyang mga kaibigan kaya hindi siya basta-basta nakikipag-usap sa mga tao.

23. Some viruses, such as the common cold and flu, can cause mild symptoms, while others, like HIV and Ebola, can be deadly.

24. Katamtaman ang pangangatawan ng nanay ko.

25. Kevin Durant is a prolific scorer and has won multiple scoring titles.

26. Les personnes âgées peuvent avoir des problèmes de communication en raison de problèmes de vue ou d'ouïe.

27. Dwayne "The Rock" Johnson is a former professional wrestler turned actor, known for his roles in films like "Jumanji" and the "Fast & Furious" franchise.

28. Nogle helte er kendte for deres modige handlinger under krig.

29. Maghapon nang nag computer ang kanyang anak.

30. Nang malaman ko ang balitang malungkot, hindi ko mapigilang maglabas ng malalim na himutok.

31. Scissors are commonly used in various industries, including arts and crafts, sewing, hairdressing, and cooking.

32. Las escuelas también tienen la responsabilidad de asegurar un ambiente seguro para los estudiantes.

33. They do not eat meat.

34. spread information and knowledge from one corner of the globe to another.

35. Ang mga kawal nagsisilbi sa bayan upang protektahan ang mamamayan.

36. Les personnes qui ont une passion pour ce qu'elles font sont souvent plus motivées à y consacrer leur temps et leur énergie.

37. Dahil sa ugali ni Aya na hindi maganda, siya ngayon ay kinaiinisan ng mga taong dati ay sa kanya pumupuri.

38. Nagkantahan kami sa karaoke bar.

39. Sa aksidente sa kalsada, maraming tao ang nasugatan at ilang pasahero ang namatay.

40. Sa hinaba-haba man daw ng prusisyon, sa simbahan din ang tuloy.

41. Ang mga bayani ay nagbibigay ng pag-asa at magandang kinabukasan para sa mga susunod na henerasyon ng mga Pilipino.

42. Sila ay nagpapakita ng dedikasyon sa paglilingkod sa kapwa at sa bayan.

43. Les personnes ayant des motivations différentes peuvent avoir des approches différentes de la réussite.

44. En algunas culturas, se celebran festivales de invierno como el Hanukkah y el solsticio de invierno.

45. Pinayuhan siya ng doktor tungkol sa pangangalaga sa bungang-araw.

46. La pièce montée était absolument délicieuse.

47. Maya-maya, muling naupo at dumukot ng isang lapis at isang maliit na kuwaderno sa kanyang bulsa.

48. Ang pagmamalabis sa paggamit ng mga plastik na bag ay nagdudulot ng environmental pollution.

49. Nagbigay ng biglaang meeting ang boss ko kanina kaya hindi ako nakapaghanda.

50. Inakalang nagtatampo ang kapatid niya, pero hindi naman pala.

Similar Words

platforms

Recent Searches

windowformszebranapadpadumakyattinalikdanpagkakakulongsinagothimutokteachingseffectslibronangingitngithiniritmanipisnakapagreklamonapilitandumalomatariktatlopaghuhugasartistdalirinakitangkasitumutubopinakabatangkagabihaltagawbakawarifonospagkamulatsalespananakopkalahiganteasomabatongnakahigangkangkonsiyertoperohitikubodinanashulimamitaskumarimotkasangkapannalalabimagbayadtumahimiktatayopinagbigyannakangisiwaysmagbunganagliliwanagcultivoikinatatakotmini-helicoptermensahemasaksihannakauwihitnakahainmaglaronaghihirapputimasayahingayamalivampirespakiramdammabagalpaulit-ulitprocessesnagpasanlikodsasapakinsinisiniyanahulogeleksyonbulongdisyembredangerousna-fundwondersundeniablemalapitanmaliitthroatbagamanakamagbigayannoonfe-facebookcarolmagkasamangusaconsistkadaratingmaestroelectionseventscollectionscommissiontwinklefaultmaramijackymanagerguiltygoteksamupworkpasswordsumapithila-agawanninasusiarkilamakamitpinalambotkaya1929panitikanwritewhileinterviewinganubayanstatingkatutubopagtutolaralkinaomelettekalalakihanhafttumingaladisensyosinasabiemocionesmarahilmusicalphilippinenatulogimagessatisfactionalituntuninmaximizingnagtatakbonaroonquicklypagsusulitkakuwentuhannagtanghalianhulingfrogipatuloymagigitingskillsnamancynthianamumulotnakatulongnapasigawlumahokpumulotmovielinawpakistantradisyoninventionbarangaypagkainisidiomawantnagitlamakakakainhinintayandoypatienceninyoiniinombatokmatapangnakasimangottiniklingotroimaginationaltukol-kaydoneinutusanginaganoonberegninger