Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

2 sentences found for "tig-bebeinte"

1. At ang hawak nitong bangos na tig-bebeinte.

2. Hawak nito ang isang maliit na bangos na tig-bebente, sa loob-loob ni Aling Marta.

Random Sentences

1. Maghanap tayo ng mga kabibi sa tabing-dagat.

2. Sa gabi ng handaan ay ipinatawag ng Ada ang lahat ng hayop at halaman.

3. Guten Abend! - Good evening!

4. Arbejdsgivere leder ofte efter erfarne medarbejdere.

5. Hinde mo pa nga pinapatapos yung sasabihin ko eh.

6. El atardecer en el mar es un momento sublime que muchos aprecian.

7. La science des données est de plus en plus importante pour l'analyse et la compréhension de grandes quantités d'informations.

8. Mag-aaral ako ngayon, datapwat sa hapon ay pupunta ako sa doktor.

9. The United States has a national motto, "In God We Trust," and a national anthem, "The Star-Spangled Banner."

10. Jeg er helt forelsket i hende. (I'm completely in love with her.)

11. Ang produktong ito ay may mataas na kalidad, samakatuwid, marami ang bumibili nito.

12. Magtatampo na ako niyan. seryosong sabi niya.

13. Ang tamang dami ng pagtulog ay nakakatulong sa pagpapalakas ng immune system.

14. You reap what you sow.

15. I am reading a book right now.

16. Electric cars have a lower center of gravity, which can improve handling and stability.

17. Maraming aklat ang naisulat tungkol kay Apolinario Mabini at ang kanyang kontribusyon sa kasaysayan ng Pilipinas.

18. The legend of Santa Claus, a beloved figure associated with Christmas, evolved from the story of Saint Nicholas, a Christian bishop known for his generosity and kindness.

19. Les personnes âgées peuvent continuer à poursuivre des activités et des hobbies qu'elles aiment.

20. Ang mga anak-pawis ay nangangailangan ng mas mataas na antas ng edukasyon upang umangat sa kanilang kalagayan.

21. The website's analytics show that the majority of its users are located in North America.

22. Proper maintenance, such as regularly oiling the pivot point and cleaning off debris, can prolong the lifespan of scissors.

23. Tara na nga Hon! Mga baliw ata yan eh!

24. Ang mga firefighter nagsisilbi upang protektahan ang mga tao mula sa mga sunog.

25. Es importante no cosechar demasiado temprano, ya que las frutas aún pueden no estar maduras.

26. Additionally, the use of mobile phones has raised concerns about privacy, as the devices can be used to track individuals' locations and gather personal information

27. Las redes sociales son una plataforma para compartir fotos y videos.

28. A couple of songs from the 80s played on the radio.

29. Maraming tao ang nagpapanggap na bukas palad upang makuha ang gusto nila, kaya kailangan nating maging maingat.

30. Television also allowed for the creation of a new form of entertainment, the television show

31. Maaaring magbigay ng libro ang guro sa akin.

32. Hindi ko maiwasang magtaka kung bakit may mga taong nagpaplastikan pa rin kahit alam nilang hindi sila magkakasundo.

33. Naging tradisyon sa aming barangay ang nagiigib ng tubig para sa binyag ng mga sanggol.

34. Nagsisilbi siya bilang abogado upang itaguyod ang katarungan sa kanyang kliyente.

35. Denne kombination har vist sig at være meget effektiv i at skabe en høj grad af velstand og velfærd for befolkningen

36. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

37. Masyadong mahal ang pagkain sa hotel.

38. Bwisit talaga ang taong yun.

39. Paano ho pumunta sa Manila Hotel?

40. Galit na galit ang ina sa anak.

41. The restaurant messed up his order, and then the waiter spilled a drink on him. That added insult to injury.

42. Cocinar en casa con ingredientes frescos es una forma fácil de comer más saludable.

43. Si quieres que la comida esté picante, agrega un poco de jalapeño.

44. Hinugot niya ang kanyang puhunan sa bangko upang magtayo ng negosyo.

45. The sun is not shining today.

46. The lightweight construction of the bicycle made it ideal for racing.

47. The momentum of the train caused it to derail when it hit a curve too quickly.

48. Einstein's legacy continues to inspire scientists and thinkers around the world.

49. Sweeteners are often used in processed foods to enhance flavor and extend shelf life.

50. Traveling to a conflict zone is considered very risky.

Recent Searches

tig-bebeintecapitalpinyahuwebesnilulonjacesorrymaitimpedrosizeraymondmapapamuchchesscontinuesadvertisinghealthprogramminghatingaggressionipinalutoreleasedmismopulang-pula1982kinauupuannyaninimbitanagpa-photocopyfatherkarangalanfitpambatangbarkobuhaythankbinatakpa-dayagonallaybrarikapekutodinirapanuusapanpaga-alalanagpalalimkalalarosharmaineutak-biyanapipilitanhahatolfameellennagsusulatibinilimalapalasyomakatulogpangangatawannovellesvitaminbloggers,surveyspinansinkaratulanglumabaskapitbahaylandlinekumustapagkainglandasdescargarmalapitroofstocknginingisihanartistahiwaduwendemahirapkumatoknahihilokatapatkindsgymngisidollymabilisbernardokelanlordplasamatchingdecisionsredbalehydelthenbalingnagtatanimdatadulodeclarehapasinlabanannerissafloormakakataloendlungsodpalapagseeknakatitighoneymoonsugalsimbahanngpuntaamazonheftysectionspanunuksongconcernspusosakaymagpapaligoyligoyreviewpinagkakaabalahanbilibidpananakophitsuragreaterjejurailabrilpapuntatiljerrykeepingouelumabanparagraphstinitirhannaawapang-araw-arawdietpunsoadoptedsawadiscoveredpierdadalhinpakikipagtagposalitaprocessesgumagalaw-galawblazingexhaustiontinaypagsumamokumikinigisasagotnoelsinasabimakukulaypacienciamagkasinggandamagagamitprincipalespinangalanangsay,lavlinggotaglagaslumilipadkisstutungopropesortumamapakukuluanhawakmangiyak-ngiyakpakanta-kantangnaglulusaklabisrewardingafternoonsangaupangngipingnabasanakakapuntapulongsabongescuelasmagsunogincidencepublicityinintaysalatinmataaasdreamsfeltcommunity