Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

2 sentences found for "philosophical"

1. Einstein's scientific work was heavily influenced by his philosophical and moral beliefs.

2. In addition to his martial arts skills, Lee was also known for his philosophical ideas and his emphasis on personal development

Random Sentences

1. Ang aming pagsasama bilang magkabilang kabiyak ay puno ng pagpapahalaga at respeto sa isa't isa.

2. Baro't saya ang isusuot ni Lily.

3. Cheating is the act of being unfaithful to a partner by engaging in romantic or sexual activities with someone else.

4. La realidad es a menudo más compleja de lo que parece.

5. Ein Bild sagt mehr als tausend Worte.

6. Makikita ko si Mrs. Santos bukas.

7. Kumaripas ng lakad ang matanda nang bumilis ang ulan.

8. James K. Polk, the eleventh president of the United States, served from 1845 to 1849 and oversaw the Mexican-American War, which resulted in the acquisition of significant territory for the United States.

9. Ang mga ibon ay wala nga namang mga pangil tulad nila kaya isinama din nila ito sa pagdiriwang.

10. Nag tinda si Aling Pusing ng isda upang may makain ang kanyang mga anak.

11. The feeling of falling in love can be euphoric and overwhelming.

12. Ang pag-asa ay nagbibigay ng kahulugan sa buhay ng mga tao sa pamamagitan ng kanilang mga pangarap at mga layunin.

13. Mas maganda si Bingbing kaysa kay Jingjing.

14. We have been waiting for the train for an hour.

15. Umuuwi siya sa probinsiya linggo-linggo.

16. Isang araw, naabutan ni Nicolas si Helena sa palasyo.

17. Hiram na kasuotan ang ginamit niya para sa theme party.

18. Les devises étrangères sont souvent utilisées dans les transactions internationales.

19. Sapagkat batay sa turo ng Katolisismo ay nagpasan ng krus at ipinako sa kabundukan si HesuKristo.

20. Marami rin silang mga alagang hayop.

21. Una conciencia pesada puede ser un signo de que necesitamos cambiar nuestra conducta.

22. Binentahan ni Aling Maria ng prutas si Katie.

23. Effective use of emphasis can enhance the power and impact of communication.

24. Athena.. malapit na tayo.. konting tiis na lang..

25. Emphasis can be used to highlight a person's strengths and abilities.

26. Ang lider ng samahan ay pinagpalaluan ng mga miyembro dahil sa kanyang integridad.

27. La realidad es que necesitamos trabajar juntos para resolver el problema.

28. His influence continues to be felt in the world of music, and his legacy lives on through the countless artists and fans who have been inspired by his work

29. Hindi mo gusto ang lasa ng gulay? Kung gayon, subukan mong lutuin ito sa ibang paraan.

30. She has finished reading the book.

31. Additionally, the advent of streaming services like Netflix and Hulu has changed the way that people consume television, and this has led to the creation of a new form of television programming, known as binge-watching

32. Handa ko pong gawin ang lahat para lang tuparin Mo po ang aking kahilingan.

33. Angelina Jolie is an acclaimed actress known for her roles in films like "Tomb Raider" and "Maleficent."

34. The stock market can be used as a tool for generating wealth and creating long-term financial security.

35. Today we can watch games, shows, and song and dance programs from all corners of the world while sitting in our own homes.

36. Sa bawat pagsubok, si Hidilyn Diaz ay laging naniniwala na ang pagsisikap ay susi sa tagumpay.

37. A couple of dogs were barking in the distance.

38. La tecnología ha permitido la creación de nueva música y la producción de grabaciones de alta calidad.

39. Transkønnede personer kan opleve diskrimination og stigmatisering på grund af deres kønsidentitet.

40. Nous avons opté pour une cérémonie de mariage intime.

41. The patient's family history of high blood pressure increased his risk of developing the condition.

42. Wag kang mag-alala.

43. The cake was so light and fluffy; it practically melted in my mouth.

44. Mura lang ang mga damit sa Greenhills.

45. Magkano ang arkila ng bisikleta?

46. Hindi ba nagdaramdam ang nanay at tatay mo?

47. I finally finished my degree at age 40 - better late than never!

48. Omelettes are a popular choice for those following a low-carb or high-protein diet.

49. Los alimentos ricos en nutrientes son fundamentales para mantener un cuerpo sano.

50. Comer regularmente comidas pequeñas y saludables durante todo el día puede ayudar a mantener niveles de energía estables.

Recent Searches

magkaibiganhastanaglokophilosophicalpopularmaabutanmariokuneabangankasoybinitiwansakimnagtatanonglumbaygearniyospecialcebubangataquespataynasuklamnapakatalinogownmayoisinamamagkapatidinaabotnaglalatangmahahanaynapakagandangryanpaghahabilalabhanunahinininomfar-reachingenglishbarrierstumikimprotestakahusayannagsasagotkalanpaki-translatedisenyoabononakapagproposekrusstatusctricassinunodpasigawnagsisipag-uwiantanodninyostandtsakameetmukhakahulugannyekapainhimselffiverrsakristansasakyanaudittinderaeithermalikotdidinghahatolkisapmatanagwikanginakalareservesmagtatanimstudiedincreasednagmistulangspentmagdaraospagkaraabantulotawarenapapasayapulgadapitakalumabas11pmmahihirapnagcurvesedentarylumikhaautomatictechnologiesnagbasabitawanimaginationaplicacionessobrabloggers,behalfenforcingbeyondcallinglumuwastilgangtracksaranggoladeterminasyonibat-ibangalignsbirthdaynakasakitsumasagotreserbasyontumingalahealthierinulitespigastokyohangganglaki-lakinanlalamignapasubsobtumagalbatakatiehelpedlatestorasimportantepaninginokaynapahintospajenayaripumilimahiwagapangarapkomunikasyonkasinagmamadaliofteiiwasanbahaymakikipaglaromonetizingdamdaminbangladeshcreationsiyamtigrepasswordsinodennesafebusyangtanaweventsrelievedreachmakatiiniwanltonaibabaniliniskindlerinluzipasokmusicaladgangnohisinuotpanindapakaininmamanhikankainanartistakusinerotelefonercelulareskakuwentuhankaninumankaninongsocietykinauupuanleksiyonpagkapasokgelaiswimmingpagngitikarangalandalawamaskikinahuhumalingan