Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

10 sentences found for "ofrecen"

1. Las escuelas ofrecen actividades extracurriculares, como deportes y clubes estudiantiles.

2. Las escuelas ofrecen diferentes planes de estudios, dependiendo del nivel y la especialización.

3. Las escuelas ofrecen programas educativos desde preescolar hasta la universidad.

4. Las escuelas privadas requieren matrícula y ofrecen diferentes programas educativos.

5. Las escuelas también ofrecen programas de apoyo, como tutorías y asesoramiento académico.

6. Las escuelas también ofrecen programas de educación para adultos.

7. Los cuerpos de agua ofrecen un hábitat para una gran diversidad de especies acuáticas.

8. Los teléfonos inteligentes son una evolución de los teléfonos móviles y ofrecen aún más funciones y capacidades

9. Los teléfonos móviles también ofrecen una variedad de funciones adicionales, como la capacidad de enviar y recibir mensajes de texto, tomar fotos, acceder a internet y utilizar aplicaciones

10. Muchas escuelas ofrecen clases de música y hay numerosas instituciones educativas especializadas en música, como conservatorios y escuelas de música

Random Sentences

1. Ang mag-aaral ay nagsusulat ng mga sanaysay at mga ulat bilang bahagi ng kanilang mga proyekto.

2. Les jeux de hasard en ligne sont devenus plus populaires ces dernières années et permettent de jouer depuis le confort de son propre domicile.

3. En af de vigtigste drivkræfter i den danske økonomi er eksporten

4. Ang pagdidilim ng kalangitan ay nagpakalma sa init ng araw at nagbigay daan sa isang magandang sunset.

5. If you think he'll lend you money, you're barking up the wrong tree.

6. They are not cooking together tonight.

7. Sa labis na pagkagalit ipinadakip mismo ng datu sa mga nasasakupan ang misyunerong nangangaral.

8. Sa condo ko. nakangiti niya pang sagot.

9. Maruming babae ang kanyang ina.

10. Calcium-rich foods, such as dairy products and tofu, are important for bone health.

11. Franklin Pierce, the fourteenth president of the United States, served from 1853 to 1857 and was known for his support of the Kansas-Nebraska Act, which contributed to the outbreak of the Civil War.

12. Pagkalipas ng dalawang linggo ay nakatanggap si Nicolas ng sulat galing kay Haring Bernardo.

13. Emphasis can help to ensure that a message is received and understood by the intended audience.

14. Mababa ang antas ng tubig sa dam, kaya nagpatupad ng water rationing.

15. Masakit ba?? Tumingin siya sa akin, Masakit na naman ba??!!

16. Cryptocurrency can be used for both legal and illegal transactions.

17. Have we completed the project on time?

18. Nang malaman ko ang kasinungalingan ng aking kaibigan, nagpalabas ako ng malalim na himutok sa aking sarili.

19. The company launched a series of new products, targeting different customer segments.

20. Wolverine has retractable adamantium claws and a regenerative healing factor.

21. Ang librong ito ay ukol kay mam Luisa na nagbigay inspirasyon sa kanyang mga estudyante.

22. Sa gitna ng pagluluto, nagitla ako nang biglang mag-expire ang gasera.

23. Lumapit ang mga tao kay Ana at humingi ng tawad sa kaniya sa pagiging marahas ng mga ito.

24.

25. Pakibigay ng lakas ng loob ang bawat isa upang magpatuloy sa buhay.

26. Kailangan ko ng lumisan mahal ko.

27. A veces, la paciencia es la mejor respuesta ante una situación difícil.

28. Børn har brug for tryghed, kærlighed og omsorg for at udvikle sig optimalt.

29. The children are playing with their toys.

30. Jeg har aldrig mødt en så fascinerende dame før. (I have never met such a fascinating lady before.)

31. The elderly are at a higher risk of developing pneumonia.

32. La lavanda es una hierba que se utiliza en aromaterapia debido a su efecto relajante.

33. Hindi dapat magpabaya sa pag-aaral upang makamit ang mga pangarap.

34. Malakas ang kamandag ng ahas na nakatuklaw kay Mang Arturo.

35. Ang paglapastangan sa mga kagamitan at ari-arian ng iba ay isang paglabag sa mga prinsipyong moral.

36. Dalawa ang kalan sa bahay namin.

37. Pasasaan ba't di iikli ang pila? naisip niya.

38. Omelettes are a popular choice for those following a low-carb or high-protein diet.

39. Sa pagsasaayos ng paaralan, ang bayanihan ng mga guro at magulang ay nagdulot ng magandang resulta.

40. Don't cry over spilt milk

41. Ang pag-asa ay nagbibigay ng pag-asa sa mga taong nakakaranas ng mga krisis at mga suliranin sa buhay.

42. Ang pag-ulan ng mga bituin sa langit ay animo'y isang mahiwagang pagnanasa.

43. Napatingin ako sa menu. Parang nagc-crave ako sa hotdog.

44. En Nochevieja, nos reunimos con amigos para celebrar el Año Nuevo.

45. Sometimes I wish I could unlearn certain things and go back to a time when I was blissfully ignorant of the world's problems - ignorance truly is bliss in some cases.

46. Magkano ang arkila kung isang linggo?

47. I absolutely agree with your point of view.

48. Another example is a decision tree algorithm, which is used to make decisions based on a series of if-then statements.

49. Fødslen kan være en tid til at reflektere over ens egne værdier og prioriteringer.

50. Nationalism has been an important factor in the formation of modern states and the boundaries between them.

Recent Searches

ofrecenlikodarbejderkatutubojudicialfederalna-fundnamataymaanghangumulannagsinemungkahimalinislimangninatumatakboactingkaybilisotroininomdiferentespatongfranakakagalingmadalingmapagkatiwalaanmahuhusaykinuhaibalikmaulitkumaensumakaysumigawdireksyonturnmagpalagosakimdiretsokaniyamastertiningnantanyagimpactedkingipatuloyguiltymaibabalikmaaksidenteiilananaykahitmakapagempakecoachingunitedmaihaharapnagbasahapdimalikotstruggledlilykaarawannagisingisusuotmagsisimulapresentaefficientprogressnapapikitsignalclassmateproperlysystemnagcurvestyrerparaangdoktorumiiyakMagandanamumukod-tangituwidAsulgustopakisabitalinopanatagTunaykuwintasmalayangpambansangtamadmalapadsagabaledukasyontotooconditionngunitaleskalayuanbusabusinmatigascombatirlas,sisidlanpinapataposnakatigilculturasescuelasstreetpagkagisingtumatawaglumiwagilagaybutchnakatingindiscipliner,palitanlugarpulgadaareaspagkakapagsalitaisinusuotmagtanghalianpamahalaaninvitationnaalisaleawitangayundinnakakapuntaapoyfremtidigerecibirnalalabingbiocombustiblestwitchcongratsikinakatwiranpinabayaankwebangnagpakunotplatformsroughmagagamittatlomoodjocelynnagkapilatkaawayreturnedsequetakotmagsaingmarielrecentpangalantechnologyrestawansinumangsubalitirogstonehamreplacedsayiossigeginagawasahigmumuranatandaanmalakitelebisyonsangadahilmalawakpagdatingmag-amaperfectisdangtumahimiktabing-dagatnagbiyayamasayaibigaynagliliyabospitalstorysparenassalapikanyamasaganangbasahankapwagumapangmasinopfreeformatsakamagalangkawayangumising