Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

10 sentences found for "ofrecen"

1. Las escuelas ofrecen actividades extracurriculares, como deportes y clubes estudiantiles.

2. Las escuelas ofrecen diferentes planes de estudios, dependiendo del nivel y la especialización.

3. Las escuelas ofrecen programas educativos desde preescolar hasta la universidad.

4. Las escuelas privadas requieren matrícula y ofrecen diferentes programas educativos.

5. Las escuelas también ofrecen programas de apoyo, como tutorías y asesoramiento académico.

6. Las escuelas también ofrecen programas de educación para adultos.

7. Los cuerpos de agua ofrecen un hábitat para una gran diversidad de especies acuáticas.

8. Los teléfonos inteligentes son una evolución de los teléfonos móviles y ofrecen aún más funciones y capacidades

9. Los teléfonos móviles también ofrecen una variedad de funciones adicionales, como la capacidad de enviar y recibir mensajes de texto, tomar fotos, acceder a internet y utilizar aplicaciones

10. Muchas escuelas ofrecen clases de música y hay numerosas instituciones educativas especializadas en música, como conservatorios y escuelas de música

Random Sentences

1. Muchas personas prefieren pasar el Día de San Valentín en casa, disfrutando de una cena romántica con su pareja.

2. Wala akong pakelam! Dapat sayo pinapalo!

3. Kailan libre si Carol sa Sabado?

4. Der er mange forskellige rollemodeller og inspirationskilder for unge kvinder.

5. Wolverine has retractable adamantium claws and a regenerative healing factor.

6. Las hierbas medicinales se utilizan desde hace siglos para tratar diversas dolencias.

7. Hindi importante kung maganda o pangit ang itsura, ang mahalaga ay hindi kababawan ng kalooban.

8. Nasa Massachusetts ang Stoneham.

9. Sumungaw ang payat na mukha ng kanyang asawa.

10. Nogle helte går frivilligt ind i farlige situationer for at redde andre.

11. Sa tuwa ng bata ay napasigaw ito at tinawag ang mga kapitbahay upang matikman din nila ang prutas.

12. Cinderella is a tale of a young girl who overcomes adversity with the help of her fairy godmother and a glass slipper.

13. Nakatanggap umano siya ng isang liham mula sa isang taong matagal nang nawala.

14. Cancer can be classified into different stages and types, which determine the treatment plan and prognosis.

15. Walang mangyayari satin kung hindi tayo kikilos.

16. Algunos músicos famosos incluyen a Mozart, Beethoven y Michael Jackson.

17. Nakita ko namang natawa yung tindera.

18. Celles-ci comprennent la thérapie, le conseil et les groupes de soutien.

19. Hindi dapat natin pahintulutan ang paglapastangan sa karapatan ng mga mahihina at marhinalisadong sektor ng lipunan.

20. Hindi siya makatulog dahil sa kati ng bungang-araw.

21. No hay mal que por bien no venga. - Every cloud has a silver lining.

22. Natuto akong magluto ng masarap na pagkain kaya masayang-masaya ako ngayon.

23. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

24. Have they finished the renovation of the house?

25. Anong oras gumigising si Katie?

26. Ang mga eksperto sa kalusugan ay nagbahagi ng kanilang mga mungkahi upang mapabuti ang mga programa sa pangangalaga sa kalusugan.

27. A wedding planner can help the couple plan and organize their wedding.

28. I don't want to cut corners on this project - let's do it right the first time.

29. El invierno comienza el 21 de diciembre en el hemisferio norte y el 21 de junio en el hemisferio sur.

30. Kailan at saan po kayo ipinanganak?

31. Arbejdsgivere kan fremme mangfoldighed og inklusion på arbejdspladsen for at skabe en retfærdig arbejdsmiljø for alle.

32. The actor received a hefty fee for their role in the blockbuster movie.

33. Malapit na matapos ang kanyang termino sa pagka senador.

34. El error en la presentación está llamando la atención del público.

35. Les personnes qui manquent de motivation peuvent être découragées et avoir des difficultés à accomplir leurs tâches.

36. Huwag kaybilis at baka may malampasan.

37. Inilista ni Michael ang lahat ng maiingay sa klase.

38. Gaano katagal ho kung sasakay ako ng dyipni?

39. They have studied English for five years.

40. At minamadali kong himayin itong bulak.

41. Este plato tiene un toque picante que lo hace especial.

42. Sa pagpanhik ng matanda sa burol ay bumuhos ang malakas na ulan, at yumanig ang lupa.

43. The children play in the playground.

44. Nationalism has been an important factor in the formation of modern states and the boundaries between them.

45. Ako si Rodona ang diwata ng budok na ito.

46. The first mobile phone was developed in 1983, and since then, the technology has continued to improve

47. Honesty is the best policy.

48. Si Anna ay maganda.

49. Kung may tiyaga, may nilaga.

50. Kami kaya ni Maico aabot sa ganyan?

Recent Searches

iniisiphanginofrecenyoutubelunesrabbapelikulasurroundingskutsilyocubicleyorkathenahotelpamanlalakekumbentomatitigassuwailpulismeronwasteexpertisevivatuvoriseiniibigfarmmagsuotumalismejodinanasiilananaybinatakoutlinebumabaghinogtaon-taonburgerpakelampitoitongcontent,animoyisipsenateinantokmestdulotdipangmakaratingipatuloyhusolossarguekrusgoodeveningcomunicandumagundongsparkideasofficepumuntawowtanimbokdagalargerwatchingmularichearlyplayedsinongintroducedrayberhumanospasyascientistexperiencesworldagosbardonfaultputilinemalabopasasalamatbownaggingconnectionevensafestreamingrightemphasisschoolcrazyeffectjunjunthirdmitigatesyncawareimpactedskyldes,nationaltamarawmatayognagpaiyaknakapamintanamakikiraanenfermedades,umupolalargaligayanatutulogsakimhinilapiyanomatutulogexigentememorialsanggolubolamangnanggagamotnapalakasatinmasipaglaganapchristmassakopbenefitsnagsimulamatutongpanunuksomaawainglagingsabadongmalilimutankumaencurtainsawitinsidomaibabalikmatalim3hrsniyonkatulong1960stiboktengaanonggreatlymaongsapilitangsantoscareernapapikitahitginugunitananunuksomakitangtabimangingibigpinagmakinanghoytrajetiningnankriskamatapangkatapatdisseiconskahitpagkakatuwaanforevernahihilopanindangbalanglumilingonkatandaanbinilhanattractivepongunahinkabutihantilaiginitgitfeelingimagingoverviewbarung-barongmagagandangnagtutulaknakakunot-noongkinakabahan