Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "generaba"

1. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

Random Sentences

1. May tawad. Sisenta pesos na lang.

2. Yes Sir! natatawa pa ako saka ko binaba yung tawag.

3. Napagkasunduan ng grupo na i-expel ang miyembro na na-suway sa kanilang code of conduct.

4. The internet is full of fashion blogs. They're a dime a dozen.

5. TikTok has been banned in some countries over concerns about national security and censorship.

6. Tumango siya tapos dumiretso na sa kwarto niya.

7. Nasaktan, nagalit din ang lola at gumanti.

8. Ang pagpapahalaga at suporta ng aking mga kaibigan ay nagpawi ng aking takot at pag-aalinlangan.

9. Malapit ang pook na ito sa bundok ng Rabba.

10. Landet har en omfattende social sikkerhedsnet, der sikrer, at alle borgere har adgang til sundhedspleje, uddannelse og sociale ydelser

11. El sismo produjo una gran destrucción en la ciudad y causó muchas muertes.

12. El Día de San Valentín es una festividad muy popular en muchos países.

13. Ang yaman pala ni Chavit!

14. Virksomheder i Danmark, der eksporterer varer, er afgørende for den danske økonomi.

15. The popularity of coffee has led to the development of several coffee-related industries, such as coffee roasting and coffee equipment manufacturing.

16. Have you tried the new coffee shop?

17. Pinayuhan sila ng albularyo na magdasal bago mag-umpisa ang gamutan.

18. Hindi ko akalaing capable ka palang tumawa.

19. El ciclo del agua es un proceso natural que involucra evaporación, condensación y precipitación.

20. La labradora de mi primo es muy protectora de la familia y siempre está alerta.

21. The momentum of the protest grew as more people joined the march.

22. Seryoso? Ngayon ka lang nakakaen sa fastfood? tanong ko.

23. His unique blend of musical styles

24. Bien hecho.

25. Pero kahit marami ang sumunod sa itinuturo ng paring Espanyol ay may isang barangay na bulag pa ring sumasamba sa mga anito.

26. Hindi natin kara-karaka madadala ito nang walang ebidensya.

27. The culprit behind the cyberattack on the company's servers was traced back to a foreign country.

28. Maghapon nang nag computer ang kanyang anak.

29. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

30. Pull yourself together and let's figure out a solution to this problem.

31. Aba'y lintek na babaeng ito! Ang langis mo! Paano na ako magugustuhan ni Pedro nyan! ani ni Ipong sabay hawi ng buhok.

32. Sí, claro que puedo ayudarte con eso.

33. Ang panaghoy ng mga pasyente ay naging panawagan para sa mas maayos na serbisyong pangkalusugan.

34. He struggled with addiction and personal issues, and his health began to deteriorate in the 1970s

35. Ano ang gustong palitan ng Monsignor?

36. Cryptocurrency offers an alternative to traditional banking systems and can be used for remittances and cross-border transactions.

37. Puti ang kulay ng pinto ng pamilyang Gasmen.

38. Motion kan også hjælpe med at reducere risikoen for visse sygdomme, såsom type 2-diabetes, hjertesygdomme og visse former for kræft.

39. From its early days as a technology for the elite, to its current status as a staple in most

40. A portion of the company's profits is allocated for charitable activities every year.

41. The Taj Mahal in India is a magnificent wonder of architecture.

42. The most famous professional hockey league is the NHL (National Hockey League), which is based in the United States and Canada.

43. Scissors should be kept sharp to ensure clean and precise cuts.

44. Omelettes can be enjoyed plain or topped with salsa, sour cream, or hot sauce for added flavor.

45. Naghingi ako ng pabor at hiramin ang sasakyan ng aking kapatid para sa isang espesyal na okasyon.

46. Nakita ni Juan ang paparating na bus kaya’t kumaripas siya para maabutan ito.

47. She has been working in the garden all day.

48. Many wives have to juggle multiple responsibilities, including work, childcare, and household chores.

49. Musk has donated significant amounts of money to charitable causes, including renewable energy research and education.

50. Kung ano ang puno, siya ang bunga.

Recent Searches

generabacasesipongblessnothingyondancetabing-dagatbinibinimahabapumiliimbesnotdamitganangkapilingbosessameexampledataattackstartedgeneratedtwoclocknapakamottobaccoinvestanibestidoailmentsjoshhdtvmagkakaroonipinabalikpawiinbagongmensajeseksportensocialehealthnamataykapaintinawagitinaasbasketballmagalinglumamangenfermedadestsakatanodpinatidkasimapakalistevenalasinginilingsiyatelevisionnalalabifauxmananaigpinagpatuloypaghihirappag-akyatkaalamantransparentkasaysayanbumagsakinisa-isapagbatisapotkasamaanpaulit-ulitnakahainnakabaonbagalfriendjaysonlawscommissiondalilagaslaskuwentoiyonpatuloybelladventgagamitnegosyanterenombrehinagud-hagodnaninirahanmakikipag-duetomagulangproducenaglaonnagsilapitpasaheronapahintodiyaryonatatawakuryentemagtigilmauliniganmateryalespersonguitarrayakapinairportnangahaselecteddagokbasahanipagbilidilimatentoisaacterminoencompasseslapitanincidencehikinginvitationkulangantokahasbuhokbarogjortinsteadulocontinuecontrolabilingeditryanvannagtutulungannagkakatipun-tiponmaipantawid-gutominintaynatulogmaiskonsultasyonnangpaki-chargenagpakunotinvesting:napaiyakmiranakalipasnakasahoddibdibcompanytennismakapagempakebowlmagkasakititinatapatpaghuhugashumihingiattorneyvictoriatumingalana-curiouspinabulaanmagselosdealtraditionalasahandisensyoalangantiemposliligawangalaanhotelpampagandateknologinagdadasalcalidadallecashmagdilimpresencekutsaritangmatangkadlumulusobyarifrescosarabinatakbulakmaingatayawfionalinggotapatcinesolar