Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "generaba"

1. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

Random Sentences

1. Les personnes âgées peuvent être victimes d'abus ou de négligence de la part de leur entourage.

2. Magkaiba man tayo ng landas ay tiyak kong magkikita pa din tayo.

3. Mahalagang magpakatotoo sa pagpapahayag ng financial status upang maiwasan ang pagkakaroon ng maraming utang.

4. The value of money can fluctuate over time due to factors such as inflation and changes in supply and demand.

5. Na parang may tumulak.

6. Hinde naman ako galit eh.

7. Les personnes âgées peuvent avoir besoin de soins médicaux réguliers pour maintenir leur santé.

8. Napaluhod siya sa madulas na semento.

9. They go to the movie theater on weekends.

10. Puwede ho ba akong lumipat ng kuwarto?

11. Elije el lugar adecuado para plantar tu maíz

12. Hoy bakit, bakit dyan ka matutulog?

13. Chatbots and virtual assistants are examples of AI applications that use natural language processing to interact with users.

14.

15. Ibinigay niya ang kanyang pag-ibig at suporta sa gitna ng mga pagsubok.

16. mga yun. Ang mahalaga ay makapagempake ako agad.

17. The beach has a variety of water sports available, from surfing to kayaking.

18. Ang abilidad na mag-isip nang malikhain ay nagbibigay daan sa paglutas ng mga problema.

19. Pwede bang sumigaw?

20. The weather is holding up, and so far so good.

21. I met a beautiful lady on my trip to Paris, and we had a wonderful conversation over coffee.

22. Wala naman. I think she likes you. Obvious naman di ba?

23. No dejes para mañana lo que puedas hacer hoy. - Don't put off until tomorrow what you can do today.

24. Naglakad ang mga sundalo sa kalsada nang limahan.

25. Maging ang mga mahihirap na disenyo ay kaya ng gawin ng bata sa murang edad.

26. Modern civilization is based upon the use of machines

27. Puwede ba siyang pumasok sa klase?

28. Nagwelga sina Ka Leo laban sa pamahalaan.

29. Las hojas de té son muy saludables y contienen antioxidantes.

30. The team has had several legendary coaches, including Phil Jackson, who led the Lakers to multiple championships during the 2000s.

31.

32. Isa lang ang bintana sa banyo namin.

33. Anong nginingisi ngisi mo dyan! May balak ka eh! Ano yun?!

34. The project is taking longer than expected, but let's hang in there and finish it.

35. Congress are elected every two years in a process known as a midterm election

36. Es importante ser honestos con nosotros mismos para tener una buena conciencia.

37. Maria, si Ginang Cruz. Guro ko siya.

38. The United States has a two-party system, with the Democratic Party and the Republican Party being the two major parties

39. Nakatanggap ng bola si Mark mula sa kanyang lolo bilang regalo.

40. Some people are allergic to pet dander and should take this into consideration before adopting a pet.

41. Sweetness can be used in savory dishes, such as sweet and sour chicken and honey-glazed ham.

42. The restaurant might look unassuming from the outside, but you can't judge a book by its cover - the food is amazing.

43. Maraming tao ang naniniwala sa kakayahan ng albularyo kahit hindi ito lisensyado.

44. Napapagod ako sa bigat ng poot na umaabot sa aking kalooban.

45. Binili ko ang sapatos dahil sa kanyang magandang disenyo, bagkus ito ay hindi gaanong komportable isuot.

46. Drømme kan være en kilde til kreativitet og innovation.

47. Bell's telephone consisted of a transmitter, which converted sound into electrical signals, and a receiver, which converted the signals back into sound

48. Sumakay ako ng taxi sa hatinggabi upang umuwi.

49. May tawad. Sisenta pesos na lang.

50. Foreclosed properties may be sold through auctions, which can be a fast-paced and competitive environment.

Recent Searches

generabarepresentedsummitpuntaestablishedmerenamungahimigguiltyuponconditioningpowersventabadingmarkeddividesbinabaelectronicfataldollargrabefacilitatingpersonsochandoipapainitwhileprogrammingsourceprocessusingautomaticmemorymakepatrickulingleadhateprocesseswaitwithoutberkeleyrefdifferentmediumactorallowsbilinggapquicklymay-arieffectsinterviewingmitigatesupportgurosaleskapwatahimikkonsentrasyonnananaginipoutpostmagagamitrooneeeehhhhiguhitinaabotbutchbeyondpasinghalikinamataynohnagtitindatuluyanpakakasalanmagtatakamaawaingpusoprutascommercialnagpasankonsyertostandpopulationblogwinsinformednilolokohvertambayankapagsanggolnaiisipjejudiyaryotinanggalkatibayangminu-minutonakakapagpatibayagricultoresmakalipashabanakumbinsigrowthdioxidepaglakimakatulogpresencekubomaayoskinaumagahangawinadvancedpalangnapatinginjoelandedapatbumugaupodinitipossincenunagam-agamlumipatlikelyulopagpasensyahanmagpaliwanagnagngangalangnakayukoh-hoynakalipassunud-sunuranfitnessumakbaybwisitabundantenagagamitmakapagempakenag-away-awaybowlnahigitanrektangguloginagawaenglandminamasdantawadasalbrasomatikmanmulighedermungkahibabalikdapit-haponrenatovistipapaputolbuslobitiwanmario11pmshopeekapangyarihansumamaultimatelybumahamaitimlateatentoumiilingpageoftenfloorpossiblemapapahalikansobramedievalcallerarbejderwastomurang-muranagpakitapaki-drawingkuwartodalamamarilmabangismabihisaninabutanprimerostuklasmahabareaksiyonginawaranmarasiganpawismisyunerongmeet