Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "generaba"

1. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

Random Sentences

1. Sometimes I wish I could go back to a time when I didn't know so much about the world - ignorance is bliss, after all.

2. Sayang, apakah kamu mau makan siang bersama aku? (Darling, would you like to have lunch with me?)

3. Hindi ko maintindihan kung bakit kailangan pang magmangiyak-ngiyak dahil sa mga simpleng bagay.

4. Hindi na siya pumasok para maabutan lang ang dalaga, ngunit, sa kasamaang palad hindi niya ito inabutan.

5. Nationalism can also lead to authoritarianism and repression of dissent.

6. Otro festival importante es el Festival Internacional de Música y Danza de Granada, que se celebra en junio y presenta una amplia variedad de géneros musicales

7. In recent years, the telephone has undergone a major transformation with the rise of mobile phones

8. Ang tubig-ulan ay isa sa mga pinakamahalagang pinagmumulan ng tubig sa mga ilog at lawa.

9. Forgiveness is a personal journey that varies for each individual; there is no set timeline or right way to forgive.

10. He has been repairing the car for hours.

11. Hakeem Olajuwon was a dominant center and one of the best shot-blockers in NBA history.

12. Sa condo ko. nakangiti niya pang sagot.

13. Este plato tiene un toque picante que lo hace especial.

14. Einstein was awarded the Nobel Prize in Physics in 1921 for his discovery of the law of the photoelectric effect.

15. She does not gossip about others.

16. Ang mga anak-pawis ay nagtatrabaho sa iba't ibang sektor ng ekonomiya, tulad ng agrikultura at pagmimina.

17.

18. No puedo dejar de dar las gracias por todo lo que has hecho por mí.

19. Sa halip na malungkot, bagkus ay nagawa pa nitong magpasalamat sa lahat ng kanyang taga-suporta.

20. Sa takot ay napabalikwas ang prinsesa at tinungo ang isang malapit na hukay.

21. Additionally, the use of mobile phones has raised concerns about privacy, as the devices can be used to track individuals' locations and gather personal information

22. El cordón umbilical, que conecta al bebé con la placenta, será cortado después del nacimiento.

23. Sa dakong huli ng deadline, nai-submit ko na rin ang aking project.

24. May nakita akong matandang nag-aalok ng pulotgata sa palengke.

25. The vertical axis of an oscilloscope represents voltage, while the horizontal axis represents time.

26. Ako. Basta babayaran kita tapos!

27. The athlete completed a series of intense workouts to prepare for the competition.

28. Ano naman ang gagawin mo sa inyong hardin? wika ng binata

29. Maligoy siya magsalita at mahirap maintindihan

30. Dansk øl og spiritus eksporteres til mange lande rundt omkring i verden.

31. Nasaan ang palikuran?

32. Les travailleurs peuvent travailler dans une variété de domaines tels que la finance, la technologie, l'éducation, etc.

33. Ang pagiging bulag sa katotohanan ay nagdudulot ng pagkaligaw sa landas ng katwiran.

34. Cheating is not always intentional and can sometimes occur due to a lack of communication or understanding between partners.

35. La música es un lenguaje universal que puede ser entendido por personas de diferentes culturas y lenguas.

36. Kay sikip na ng daraanan ay patakbo ka pa kung lumabas!

37. Das Gewissen ist unsere innere Stimme, die uns sagt, was richtig und falsch ist.

38. Pinadala na nya ang kanyang resignation letter sa pamamagitan ng email.

39. Araw- araw nangangahoy si Mang Kandoy sa kagubatan para gawing uling.

40. Makabalik na nga sa klase! inis na sabi ko.

41. Hun er en af ​​de smukkeste kvinder, jeg nogensinde har set. (She is one of the most beautiful women I have ever seen.)

42. Ako na ang bahala dito. aniya at akmang tatayo na.

43. Mahiwaga ang espada ni Flavio.

44. Don't be fooled by the marketing gimmick, there's no such thing as a free lunch.

45. Bakit ka natawa? Bakit ka nakangiti?

46. Sehari di negeri sendiri lebih baik daripada seribu hari di negeri orang.

47. The king's royal palace is his residence and often serves as the seat of government.

48. Mis amigos y yo estamos planeando un viaje a la playa para el verano.

49. The widespread use of the telephone has had a profound impact on society

50. Facebook offers various features like photo albums, events, marketplace, and games to enhance user experience and engagement.

Recent Searches

activitygenerabajobsnearpatutunguhannakalagaypinamalagipagkabuhaymagpapigilencuestassementeryolumutangikatlongsumalakaymaisiptengaincredibledespueskendimagigitingmatigaspsssnaiyakpalaykutonakatingingfuelramdambabesstrengthmakakatakaspshleftreleasedconditioningmabubuhaykumalantogsabisagotikinamataymagta-trabahokapepabalingatkabilangsulyapmagpalibredahan-dahanfactoresdiinkinumutannabigyansinisiratinuturoreplacedmasungititinaobisinalaysaysumasaliwmandirigmangpampagandavivamissionumagabalotnagreklamoutilizarnatulogmataposangkanponglamesaacademycryptocurrencypariboholfinishedleemadecompartenlatestbehaviorkartonumarawfistsburmatinatanongtiniradorkutsilyomagkasintahanhinagud-hagodnamumulotsikre,communitynagmadalingpartiesmayabongforskel,paki-chargekare-karepumiliintensidadmagpagupitpasasalamatipinatawagkuripotginoongmanaloumiwaspamamahingakuwebanatulakbalatincidencemariamailapbossbilaoinatakepamimilhingmatulislapitanginangemocionessayhulibilisproducirbinibinimamayapdatopic,palagingprotestacontrolaauthormanagertagakmaskarabuhawihabangnanghuhulibio-gas-developingpasensiyamedya-agwanagngangalangikinabubuhaycallinglalakadmakapaibabawpinaghatidanpinigilanmarasiganapatnapubaboyindustriyagumigisingasukalnagwo-workadvancementnaantigkanilaginawarankanayangbiyerneskamustatagaroonproducts:nahulaanbangkoherramientaaffiliateibinentamaliniscompostelagisingpusoipasokminutefloorfencingmonetizingsteerpersistent,ipihitpointmagkikitainspirasyonnagtungonakatuwaangluluwassaritamagpaliwanagsatinkumalmaphilanthropymakakibomauupoinilistamagbantaynakainom