Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

4 sentences found for "press"

1. Coffee can be prepared in a variety of ways, including drip brewing, espresso, and French press.

2. If you are self-publishing, you will need to choose a platform to sell your book, such as Amazon Kindle Direct Publishing or Barnes & Noble Press

3. The politician tried to keep their running mate a secret, but someone in their campaign let the cat out of the bag to the press.

4. The United States has a strong tradition of individual freedom, including freedom of speech, religion, and the press.

Random Sentences

1. Magkita tayo bukas, ha? Please..

2. Aku sayang kamu lebih dari apapun, sayang. (I love you more than anything, darling.)

3. The dedication of mentors and role models can positively influence and shape the lives of others.

4. It is one of the most important inventions in human history, as it has revolutionized the way we communicate and has played a crucial role in shaping modern society

5. Hindi siya malilimutin dati, ngunit nagbago ito nang siya’y tumanda.

6. Kumusta ang nilagang baka mo?

7. Hindi mapigilan ang panaghoy ng binata nang mabasa ang liham ng kanyang mahal.

8. Ang lahat ng problema.

9. Nasawi ang drayber ng isang kotse.

10. Ano ang paborito mong pagkain?

11. Magandang Umaga!

12. May isinulat na sanaysay ang isang mag-aaral ukol kay Gabriela Silang.

13. Limitations can be overcome through perseverance, determination, and resourcefulness.

14. He maintained a contentious relationship with the media, frequently referring to some outlets as "fake news."

15. Sa bawat pagkakataon na binibigyan tayo ng pagkakataon, dapat nating gamitin ito nang wasto, samakatuwid.

16. Les patients sont suivis de près par les professionnels de santé pour s'assurer de leur rétablissement.

17. Forgiveness requires a willingness to let go of the desire for revenge or retribution and choose compassion instead.

18. Les assistants personnels virtuels, tels que Siri et Alexa, utilisent l'intelligence artificielle pour fournir des réponses aux questions des utilisateurs.

19. En tung samvittighed kan være en kilde til stor stress og angst.

20. Uncertainty can create opportunities for growth and development.

21. La esperanza es un recordatorio de que siempre hay algo bueno en el futuro, incluso si no podemos verlo en el momento. (Hope is a reminder that there is always something good in the future, even if we can't see it at the moment.)

22. Si Tom ay masipag sa trabaho, datapwat hindi marunong mag-ayos ng kanyang mga gamit.

23. Nationalism can be a source of inspiration for artists, writers, and musicians.

24. Saan pa kundi sa aking pitaka.

25. Les neuroscientifiques étudient le fonctionnement du cerveau et du système nerveux.

26. Di na niya makuha pang ipasok ang pisi ng beyblade upang mapaikot ito.

27. Hindi ko alam kung may chance ako, pero sana pwede ba kitang mahalin?

28. Maaari mo ng bitawan ang girlfriend ko, alam mo yun?

29. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

30. Laging pinapasaya ni Nicolas si Helena kaya tuwang tuwa ang mga magulang nito sa kanya, itinuring na siyang kapamilya ng mga ito

31. Inalagaan ng mag-asawa ang halaman at nang lumaki ay nagkabunga.

32. Ang maliit na aso ay hinahabol ang anino ng saranggola.

33. Mas maganda ang ambiance sa dapit-hapon kaysa sa ibang oras ng araw.

34. The doctor advised him to get plenty of rest and fluids to recover from pneumonia.

35. Weddings are typically celebrated with family and friends.

36. Musk has been described as a visionary and a disruptor in the business world.

37. Las labradoras son excelentes perros de trabajo y se utilizan a menudo en búsqueda y rescate.

38. Ang republika na itinatag niya ang unang demokratikong republika sa Asya.

39. Puwede bang makausap si Clara?

40. The website's search function is very effective, making it easy to find the information you need.

41. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

42. Biglaan ang pag-ulan kanina kaya ako ay nabasa nang husto.

43. Nakapag-celebrate kami ng aming anniversary ng asawa ko kaya masayang-masaya ako ngayon.

44. Sa takip-silim, nakakapagbigay ng romantikong vibe sa mga tao.

45. Football has a rich history and cultural significance, with many traditions and customs associated with the sport.

46. Ang talambuhay ni Andres Bonifacio ay nagpapakita ng kanyang matatag na pagtitiis sa gitna ng mga pagsubok.

47. Sa oras na makaipon ako, bibili ako ng tiket.

48. Halos de-lata na lang ang lagi nitong inuulam.

49. The project gained momentum after the team received funding.

50. Hindi ako sang-ayon sa pagdami ng mga krimen sa ating lipunan.

Similar Words

expressions

Recent Searches

pressnecesarioprogramsnapilingcomputermakapilingtutorialsusingprogramamethodsprogramming,thirdmemorylearningautomaticknowledgesolidifyshifttopicformatcreategitanasinityeahbinilingentrysalapievolvedwaitberkeleyinformedpracticeslibroexplainmonitorbilingsambitremembertypeshighestipinalutoskillroughgoinginaapitechnologiesservicescommercerepresentedfacultylargestreamingestablishedinternalimprovedbasacountless1982everydeclareonlymotionuponumanogrupoh-hoynawalakasoynagbibirotumawagsilid-aralanibinaonbakemaaliwalaslilikonandyanmarvincertaintabingpakealamhunyoiintayinabalahveralituntuninangkingkapangyarihanhomespag-aaralmaitimmapapaimpitcellphoneinakalatakesubalitnagmamaktolnakabibinginganywherejanhumabibukasnawalangahittalinoapollotaonguusapanpersonalfysik,nai-dialmadungiskakutisusuariokommunikerersay,pakikipaglabanlumabasinagawsagutinculturasumiisodkuwentostorytumikimnanalomagsunogpuntahanipinatawagbowlalapaappoorernanunuksopananglawmakapagempakenagdabogdistanciananunuriuulaminmamalasmaibibigaymaanghangnapatigilnakakainkontratanakasakitmagkasabayninanaisbalahibomagtatanimpilipinasnapasubsobactualidadnapapahintotangeksmakabilikayabanganmakasalanangnagwaginalalabingmarurumimakakibomakikituloglumuwasdiwatakumakantanapaghatiankotsengsabikinabubuhaykarunungannahuhumalingglobalisasyonpaglalaitcultivarnanahimiknanlilisikmagbayadpamamasyalnahawakanlumiwagpinahalatakinikilalangnagpaalampagsalakaynegosyantenagmamadalinagsasagotnakalagaysasayawinnasasakupannakalilipasmangangahoyibinubulongmagtanghalianalikabukinkapangyarihangeskwelahannagsisigawnagandahan