Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

16 sentences found for "center"

1. Ang mga tao na gumagamit ng droga ay maaaring tumanggap ng tulong sa mga rehab center upang magbago ang kanilang buhay.

2. Electric cars have a lower center of gravity, which can improve handling and stability.

3. Hakeem Olajuwon was a dominant center and one of the best shot-blockers in NBA history.

4. Los Angeles is considered the entertainment capital of the world, with Hollywood being the center of the film and television industry.

5. Magdamagan ang trabaho nila sa call center.

6. Magdamagan silang nagtrabaho sa call center.

7. Muchas empresas utilizan números de teléfono de línea directa o números de call center para brindar soporte técnico o atención al cliente

8. Nagtatrabaho ako sa Student Center.

9. Nagtatrabaho ako sa Youth Center.

10. Nakapila ako sa bayad center upang magbayad ng kuryente.

11. Shaquille O'Neal was a dominant center known for his size and strength.

12. Sumakay ka sa harap ng Faculty Center.

13. The Getty Center and the Los Angeles County Museum of Art (LACMA) are renowned art institutions in the city.

14. The sports center offers a variety of activities, from swimming to tennis.

15. The team's colors are purple and gold, and they play their home games at the Staples Center.

16. They volunteer at the community center.

Random Sentences

1. Sa dakong huli, na-realize ko na mahalaga ang aking mga kaibigan.

2. Bilhan mo ang bata ng Bumili ka ng kendi para

3. Palibhasa ay mahilig mag-aral at magpahusay sa kanyang mga kakayahan.

4. Sinigurado ko na mayroon akong sapat na oras bago magdilim sa dakong huli ng araw.

5. Kung walang tiyaga, walang nilaga.

6. Kumain ka ng gulay upang maging malusog ka.

7. Les employeurs peuvent utiliser des méthodes de travail flexibles pour aider les travailleurs à équilibrer leur vie professionnelle et personnelle.

8. Alam mo ba kung bakit takot si Cross sa hospital?

9. Ang laki nang mga gusali sa maynila!

10. Aray! Bakit mo ako sinapak! Potaena mo naman!

11. Nous allons visiter le Louvre demain.

12. A couple of candles lit up the room and created a cozy atmosphere.

13. Born in Tupelo, Mississippi in 1935, Presley grew up listening to gospel music, country, and blues

14. Sa mga malulubhang kaso, kailangan ng pagpapakonsulta sa espesyalista na dentista.

15. Ngunit isang araw ay naubos na ang pasensiya ni Perla at nagalit kay Amparo na laging nagrereklamo sa kanilang ulam.

16. Claro que entiendo tu punto de vista.

17. Ahh nasa shower kasi si Maico sinagot ko na baka impor...

18. She admires her mentor's leadership skills and work ethic.

19. Sa kasal, ang mga dalagang kasama ng bride ay nagdadala ng mga bulaklak at kumakanta.

20. Ang pagmamalabis sa pagkain ng matataba at malasa ay maaaring magdulot ng problema sa kalusugan.

21. Tumulo ang laway niya nang nakita niya ang pinaka-masarap na kakanin na inihain sa kanya.

22. Sa aking hardin, ako ay nagtatanim ng mga bulaklak.

23. Les entreprises cherchent souvent à maximiser leurs profits.

24. El maíz es uno de los principales cultivos agrícolas en muchos países de América Latina.

25. Mabuti na lamang at nandyan ang kanyang kaibigan.

26. El teléfono también ha tenido un gran impacto en la forma en que las empresas se comunican con sus clientes

27. Investing can be a long-term strategy for building wealth and achieving financial goals.

28. Users can create an account on Instagram and customize their profile with a profile picture, bio, and other details.

29. Ang yaman naman nila.

30. Ang paggamit ng droga ay maaaring magdulot ng mga epekto sa pag-iisip, emosyon, at pisikal na kalusugan ng isang tao.

31. Pinarusahan ang empleyado na na-suway sa patakaran ng kumpanya.

32. Kahit may konting takot sa kanyang kalooban ay minabuti niyang tignan kung ano ang nasa loob ng kweba.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Different investment vehicles may be subject to different fees and expenses, and investors should consider these costs when making investment decisions.

35. Las vacaciones son un momento para crear recuerdos inolvidables con seres queridos.

36. Ang tubig-ulan ay tumutukoy sa ulan na mayaman sa tubig at mahabang tagal.

37. "Ang taong nagiging bato sa huli, dapat alisin ang sariling uka" ay isang bukambibig na nagpapahiwatig na ang mga taong nagiging matigas ang loob o nagbubulag-bulagan sa mga sitwasyon ay dapat magbago.

38. Anong oras mo gustong umalis ng bahay?

39. Otro festival importante es el Festival Internacional de Música y Danza de Granada, que se celebra en junio y presenta una amplia variedad de géneros musicales

40. The Discover feature on Instagram suggests accounts and content based on a user's interests and interactions.

41. Hindi niya inaasahan ang biglaang pagbisita ng kanyang kaibigan.

42. Bersatu kita teguh, bercerai kita runtuh.

43. Nakakatuwa ang maliliit na kubyertos na ibinibigay sa mga bata sa mga children's party.

44. The candidate who wins the most electoral votes becomes the President

45. Palibhasa'y walang kalaro, ang mga hayop na lang ang ginawang libangan nito.

46. Kung siya ay salamangkero, bakit hindi niya ginamit ang kapangyahiran niya sa akin?

47. Sa gitna ng mga problema, hindi ko mapigilang maglabas ng malalim na himutok.

48. Ailments can impact different organs and systems in the body, such as the respiratory system or cardiovascular system.

49. A couple of pieces of chocolate are enough to satisfy my sweet tooth.

50. In the early days, telephones were connected to a central switchboard, which connected calls manually

Recent Searches

centernag-aaralkaguluhannag-iisangmalinissakahindinakatunghayinutusanmangyayarimagagalingmabagalalamdesarrollarhulihanpaggawamasasabimadridilagaymaiingayevolveanak-pawisarawtumigildemritakatedralstarkamawowabenacualquierlawaevencandidatescupidamoymatapanghatinggabibeinteerlindapebreroipagtatapatagam-agamtillbinibinikaramikaraokepasigawrebolusyonmag-anakbilanginalas-dosnagpapaniwalapalibhasapayongcarriesdeterminasyonmoviesnaalispolopagbibiromatulogmaya-mayaorderinprogramanagbabalapagkatakotednamang-aawitbayangadditionallymagulayawdiscipliner,sukatpaninginpinag-aralanadvertising,maasimdaddynakakatakotpawisbangkovasquesmalakiandremangingibigdinaluhantalentedproduktivitettandanabigyanyumabongkaawaybitaminapacienciasakimtools,mahigpiteithersamakatwidsinasiniyasatcauseskaramdamansultanalmusalnatitiyaknapakasipaglilybalikartificialpunonauliniganmatumalmalihissigebangnag-isipsabadopagkakatayoworrysinehansamang-paladkangitannahintakutanmayamayahiramin,ryanhanggangdumatinghalamanghinalungkatdarkmesataksimaramiawitmakapangyarihannakakarinigilangmangangahoyanak-mahirapmagtipidnalamanshiningtransparentkabuhayandisposalmagbagong-anyopaskosagingmalikotnapagsilbihanilalimpangaraptusongmaalaladingginemaildiyosgustonagdaoss-sorrymasukolbefolkningen,enforcingisusuotlandaspalapittayoaktibistagumisingninyongdisyembremaghaponmahalintradisyontumulongsusiitomahinalasayudapootumiyaksasakyanpapansininlibroumangatgagawinaregladomaalwangkakilalanatitiramarangalbarabasmagandangmahahalikhinihiling