Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "artists"

1. Dedication is the driving force behind artists who spend countless hours honing their craft.

2. He was one of the first martial artists to bring traditional Chinese martial arts to the Western world and helped to popularize martial arts in the United States and around the world

3. His films, teachings, and philosophy continue to inspire and guide martial artists of all styles

4. His influence continues to be felt in the world of music, and his legacy lives on through the countless artists and fans who have been inspired by his work

5. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

6. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

7. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

8. Nationalism can be a source of inspiration for artists, writers, and musicians.

9. She has collaborated with several prominent artists, including The Weeknd, Nicki Minaj, and Lady Gaga.

Random Sentences

1. The beaten eggs are then poured into a heated and greased pan.

2. Frustration is a feeling of disappointment, annoyance, or anger that arises when we are unable to achieve a desired outcome.

3. Ang poot ay isang damdamin na hindi madaling malunasan o mapawi.

4. Si Aling Pising naman ay nagpupunta sa bayan upang ipagbili ang mga nagawang uling.

5. May bakante ho sa ikawalong palapag.

6. Pakiramdam ko ngayon ay puno ng inis dahil sa ginawa mo.

7. Con permiso ¿Puedo pasar?

8. La tos es un mecanismo de defensa del cuerpo para expulsar sustancias extrañas de los pulmones.

9. Ang hina ng signal ng wifi.

10. I have a tradition of taking a photo every year on my birthday to document how I've changed over time.

11. Es ist wichtig, ehrlich zu sich selbst zu sein, um eine gute Gewissensentscheidung treffen zu können.

12. I usually like to tell a joke to break the ice at the beginning of a presentation.

13. Si Ogor ang kanyang natingala.

14. Adopting a pet from a shelter can provide a loving home for an animal in need.

15. Nosotros nos disfrazamos y vamos a fiestas de Halloween durante las vacaciones.

16. Isa kang hampaslupa! saad ng matapobreng babae.

17. The Grand Canyon is a breathtaking wonder of nature in the United States.

18. Russell Westbrook is known for his explosive athleticism and ability to record triple-doubles.

19. Patients and their families may need to coordinate with healthcare providers, insurance companies, and other organizations during hospitalization.

20. Nabagalan ako sa takbo ng programa.

21. The culprit behind the data breach was able to exploit a weakness in the company's security.

22. "Walang imposible basta may tiyaga," ani ng isang matagumpay na negosyante.

23. Eine gute Gewissensentscheidung kann uns helfen, unser Leben in eine positive Richtung zu lenken.

24. These films helped to further cement Presley's status as a cultural icon and helped to solidify his place in the history of American entertainment

25.

26. Det er vigtigt at være opmærksom på de mulige risici og udføre grundig forskning, før man beslutter sig for at deltage i gamblingaktiviteter.

27. May ipinadala pong pakete sa akin ang ate ko.

28. La música española es rica en historia y diversidad, con una variedad de géneros y estilos

29. Nakarating na kami sa aming pupuntahan.

30. Malapit na ang araw ng kalayaan.

31. Ilang tao ang pumunta sa libing?

32. Napangiti ako bigla. Yun lang ba yung problema niya?

33. The dancers are not rehearsing for their performance tonight.

34. Masama pa ba ang pakiramdam mo?

35. Danmark eksporterer mange forskellige varer til lande over hele verden.

36. Las redes sociales pueden ser adictivas y consumir mucho tiempo.

37. Ipaliwanag ang mga sumusunod na salita.

38. He has been playing video games for hours.

39. Ano ang pinabili niya sa nanay niya?

40. El cultivo de frutas tropicales como el plátano y la piña es común en países cálidos.

41. At blive kvinde handler også om at lære at håndtere livets udfordringer og modgang.

42. Cancer survivors can face physical and emotional challenges during and after treatment, such as fatigue, anxiety, and depression.

43. Elektroniske apparater kan hjælpe med at forbedre undervisning og læring i uddannelsessystemet.

44. Además, el teléfono ha sido una herramienta valiosa en la venta telefónica y en la realización de encuestas

45. The concept of God has also been used to justify social and political structures, with some societies claiming divine authority for their rulers or laws.

46. Hindi dapat nating kalimutan ang ating mga pangarap kahit na nagbabago na ang ating mga prioridad sa buhay.

47. Ketika menghadapi tantangan hidup, penting untuk menjaga keseimbangan antara kerja keras dan istirahat yang cukup.

48. Det kan omfatte spil som kasinospil, lotteri, sportsbetting og online spil.

49. Dapat bigyang pansin ang kawalan ng seguridad sa trabaho ng mga manggagawa at magsasaka bilang bahagi ng sektor ng anak-pawis.

50. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

Recent Searches

artistscarrieskaugnayanknightjenamarmaingamindilamakahiramsayawandietnoobotantekasingtigastaaslandolintafar-reachingmansanasitutoldangeroussoremaalogrosepakpakteleviewingrailwaysarghsumabogmalagotendermisuseddahonfloorpostermeanspaghettispasaringinterestrisk1973maaringenergiplatohimselfdebatesdeclarerelevantlayunindollaryonbakeconnectionpersonsideaeksamlearningdevelopmentlibrodulolutuinsupportlasingfeedbackalignsiginitgitpagkalungkotgumuhitvictoriakamukhalumipadfonomerchandisebinabaratentrynagkantahanmahalbiglaanpeacemaranasangabinag-aralpagkapasokcombinedkahulugantalanapahintoanak-mahirapmagkaparehonahintakutangabingwinsbalotnakangitingmisteryointensidadsarilingosakapawiinmatipunotinapaycirclekaibaoscarmaarikalabawdaangmahabangnagsalitagodmatagpuanvirksomheder,napahingaevolvedpaghihingalonapakasipaghitanabighaninakapaligidgagawinpagdukwangmahiwagangpaglalabadanakatuwaangmagkaibigangayunmannapakatalinonag-aalanganeskuwelahanmanamis-namisnakapagreklamoaraw-arawnagsusulatnakakapamasyalkumembut-kembotnagpapaniwalanamulaklakoktubrenakatiramanggagalingjobslumiwanagpakanta-kantangnagtungosabadongnagtatanongmapayapagrupomakatatlotradisyonngumingisitutungoinakalamahinogsundalonamataypagkasabitumatanglawnasagutannapakabilisminatamissasakaymaghahabipatakbofrancisconagtataenanunuksolangpigilansumasayawniyontinikmanafternoonjeepneynatitiyaktumingalanaliligosugatangnatakotconclusion,banalbumaliknapadpadmusicalhinagismakapalagdisensyohalinglingnatatanawplanning,magdilimbibigyanipinangangakcurtainsctricaspakibigaykusinaemocionalibabaw