Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "artists"

1. Dedication is the driving force behind artists who spend countless hours honing their craft.

2. He was one of the first martial artists to bring traditional Chinese martial arts to the Western world and helped to popularize martial arts in the United States and around the world

3. His films, teachings, and philosophy continue to inspire and guide martial artists of all styles

4. His influence continues to be felt in the world of music, and his legacy lives on through the countless artists and fans who have been inspired by his work

5. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

6. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

7. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

8. Nationalism can be a source of inspiration for artists, writers, and musicians.

9. She has collaborated with several prominent artists, including The Weeknd, Nicki Minaj, and Lady Gaga.

Random Sentences

1. Promote your book: Once your book is published, it's important to promote it to potential readers

2. Kailangang salatin mo ang tela para malaman kung gaano ito kalambot.

3. Es importante tener en cuenta la privacidad y la seguridad al utilizar las redes sociales.

4. Kakain si Pedro sa bahay ni Juan.

5. Alam kong parang biglaan, pero sana pwede ba kita makilala?

6. An omelette is a dish made from beaten eggs cooked in a pan.

7. Paki-basa po ang kuwento para sa akin.

8. Sa bata nakatingin ang pulis na wari'y nag-iisip ng dapat gawin.

9. Hindi maganda na supilin ang kalayaan ng mga mamamahayag sa bansa.

10. Tienes que tener paciencia para lograr buenos resultados.

11. Hinagud-hagod niya ang mga kamao.

12. The game is played with two teams of five players each.

13. La creatividad es una habilidad que se puede desarrollar con la práctica y el esfuerzo.

14. Nagkapilat ako dahil malalim ang sugat ko.

15. Nahantad ang mukha ni Ogor.

16. Wow, talaga? Para kayong vampires, sa gabi nabubuhay.

17. Estoy sudando mucho. (I'm sweating a lot.)

18. Sinubukan kong gumawa ng kakanin gamit ang pulotgata, ngunit hindi ko nagustuhan ang lasa.

19. Ang bukas palad na pagbibigay ay hindi palaging tungkol sa pera, pwede rin naman itong mga bagay na hindi nakakalat.

20. Musk has been named one of the most influential people in the world by TIME magazine.

21. Tila hindi siya sang-ayon sa naging desisyon ng grupo.

22. Nakatayo siya sa gilid ng bangin, waring nag-iisip nang malalim.

23. As a lightweight boxer, he had to maintain a strict diet to stay within his weight class.

24. Has she read the book already?

25. El parto natural implica dar a luz a través del canal vaginal, mientras que la cesárea es una operación quirúrgica que implica hacer una incisión en el abdomen de la madre.

26. Emphasis can be used to create a sense of drama or suspense.

27. Ini sangat enak! - This is very delicious!

28. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

29. Nakakamangha ang mga tanawin sa isla.

30. La conexión a internet se puede hacer a través de una variedad de dispositivos, como computadoras, teléfonos inteligentes y tabletas.

31. Las hojas de las plantas de té deben secarse correctamente para obtener el mejor sabor.

32. Det er vigtigt at være opmærksom på de mulige risici og udføre grundig forskning, før man beslutter sig for at deltage i gamblingaktiviteter.

33. La pimienta cayena es muy picante, no la uses en exceso.

34. The baby is sleeping in the crib.

35. Certaines personnes sont prêtes à tout pour obtenir de l'argent.

36. She does not use her phone while driving.

37. Pininturahan nila ang bahay ng puti upang magmukhang maaliwalas.

38. Der er ingen grund til at skynde sig. Vi kan tage det roligt. (There's no need to hurry. We can take it easy.)

39. Hinde ko alam kung bakit.

40. Athena.. malapit na tayo.. konting tiis na lang..

41. Namiss kita eh. Sabay ngiti ko sa kanya.

42. Anong linya ho ang papuntang Monumento?

43. Dedication is the commitment and perseverance towards achieving a goal or purpose.

44. The Parthenon in Athens is a marvel and one of the most famous wonders of classical Greek architecture.

45. Ang arte. bulong ko sa may batok niya.

46. Presley's influence on American culture is undeniable

47. Aba oo, yun lang pala, nakakunot-noong sagot ni Kablan.

48. Kailangan mong matuto ng pagsusuri upang mas maintindihan ang kaibuturan ng isang sitwasyon.

49. Tumawa siya. Thank you Jackz! See ya! Bye! Mwuaaahh!!

50. Ngayon lang ako nag mahal ng ganito.

Recent Searches

stillpamagatartistsnaglakadtamiskarnabaltrentacreceriniintaypalayoimbesmakikipagbabagbansangmagta-trabahopayongprinttipnakauslinghiraptrycycleumiilingyumuyukoipinikitultimatelyngipingshorttumaposnanaypapalapitsignificantpalayanumiiyakresortalaalamaaariaywanmagisipmahiwagavaliosatarcilamanlalakbaymagpuntatumindigbaguionakabiladcuthalosutilizanminamahalkanangoverviewcontinueimprovedoutlineitlogipapaputolnagkakakainkumakalansinglumalangoyconditionconsuelopaanannabighaniininomlihiminilabasayawpakanta-kantangnagdaramdambumisitatumalonstarspalaisipanpumayagendeligwalang-tiyakipanghampaskalabankinukuyomkantahanpangkatpotentialinalagaanmanahimikbreakharingiparatingmayabangvehiclestitapumuntanaapektuhaniiyakrhythmmakinangprofoundgrahamseeligaligdasalkahongmaaricigarettekalawakanbotantehinigitmatipunokumpunihinkaugnayanipaghandanalagutannagpuyoschamberschickenpoxnagnakawmorninghigakumaripashampaslupaknightnagingpocahelpfulcontentnakatiramalamangtumakbobroughtmasayang-masayangumagamagpaliwanagmagsayangpalibhasailantatayservicesnutrientesharmfulnagagamitcontrolarlasmagnakawcharmingkakayanangpagkatakotngpuntapatrickadverselyconsiderarperomunawinsmaluwangasiaticmanggagalingsansingeriyakpagpapautangbulalaspamanhikannatabunannamulaklakeksport,malapitanpagsisisinangingisaybefolkningenpagbatibinuksandiferentespadabogtumawatig-bebentepagsuboksabihinkadalagahangmamalaskatolisismocarmenkuwartokuwentoarbejdsstyrkefestivalespinagalitanestadosescuelasfriendsemphasisnapilitanmatuklasannagta-trabahopagkapasokparkeanasisidlanhinimas-himasagwadorpanghabambuhayinterests,marilou