Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "edsa"

1. May grupo ng aktibista sa EDSA.

Random Sentences

1. Makikita ko ang mga kapatid ko sa pasko.

2. Matagal ko nang pinapaliwanag sa kanila ang mga dahilan kung bakit ako tumututol sa kanilang plano.

3. She always submits her assignments early because she knows the early bird gets the worm.

4. Nag hiking kami sa Mt. Makiling.

5. Wala ho akong dinukot na maski ano sa kanya.

6. In conclusion, the telephone is one of the most important inventions in human history

7. Ang amoy ng sariwang ligo ay nagbibigay ng mabangong pakiramdam sa buong araw.

8. It's so loud in here - the rain is coming down so hard it's like it's raining cats and dogs on the roof.

9. Puwede akong tumulong kay Mario.

10. Support groups and resources are available to help patients and families cope with the challenges of leukemia.

11. Einstein was a pacifist and advocated for world peace, speaking out against nuclear weapons and war.

12. The development of vaccines and antibiotics has greatly reduced the incidence of infectious diseases, while the use of medical imaging and diagnostic tools has improved the accuracy and speed of diagnoses

13. Maraming natutunan ang mga estudyante dahil sa magaling na pagtuturo ng guro.

14. Taga-Ochando, New Washington ako.

15. Bagaimanakah kabarmu hari ini? (How are you today?)

16. The church organized a charitable drive to distribute food to the homeless.

17. Ayon sa albularyo, may nakabati raw sa sanggol kaya siya nagkasakit.

18. La música es una forma de arte que ha evolucionado a lo largo del tiempo.

19. Gusto ko na po mamanhikan bukas.

20. Sa pag-aaral ng mga palaisipan, mahalagang maging mapanuri at malikhain upang malutas ang suliranin.

21. Hindi siya naging maramot at inialay ang kanyang huling barya para sa donation drive.

22. No tengo palabras para expresar cuánto te agradezco.

23. Eine Inflation kann auch die Investitionen in Forschung und Entwicklung beeinflussen.

24. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

25. Kailangan mong mag-isip nang malalim upang makita mo ang kaibuturan ng kanyang problema.

26. Las redes sociales tienen un impacto en la forma en que las personas se comunican y relacionan.

27. Investors with a higher risk tolerance may be more comfortable investing in higher-risk investments with the potential for higher returns.

28. Nag-aaral ka ba sa University of London?

29. He was warned not to burn bridges with his current company before accepting a new job offer.

30. Wala naman sa palagay ko.

31. Ang pag-asa ay nagbibigay ng pagkakaisa sa mga tao sa kanilang pangarap at mga layunin sa buhay.

32. Many dogs enjoy going on walks and exploring new environments.

33. Pepes adalah makanan yang terbuat dari ikan atau daging yang dibungkus dengan daun pisang dan dimasak dengan rempah-rempah.

34. Tuwang-tuwa pa siyang humalakhak.

35. Nationalism has played a significant role in many historical events, including the two World Wars.

36. Isang araw, may nakitang halaman si Aling Rosa sa kanyang bakuran.

37. Ang pag-asa ay nagbibigay ng mga oportunidad sa mga tao upang magpakatotoo at magpakabuti.

38. The invention of the telephone led to the creation of the first radio dramas and comedies

39. Las plantas pueden entrar en un estado de dormancia durante el invierno, reduciendo su crecimiento.

40. Emphasis can also be used to create a sense of urgency or importance.

41. Lazada offers a fulfillment service called Fulfillment by Lazada (FBL), which allows sellers to store their products in Lazada's warehouses and have Lazada handle shipping and customer service.

42. Unrealistic expectations can contribute to feelings of frustration and disappointment.

43. Les parents sont encouragés à participer activement à l'éducation de leurs enfants.

44. El arte puede ser utilizado para transmitir emociones y mensajes.

45. Sa katagalan, natanggap na niya ang panunuksong ito.

46. Occupational safety and health regulations are in place to protect workers from physical harm in the workplace.

47. The fillings are added to the omelette while it is still cooking, either on top or folded inside.

48. I've been using this new software, and so far so good.

49. Ariana first gained fame as an actress, starring as Cat Valentine on Nickelodeon's shows Victorious and Sam & Cat.

50. Las serpientes mudan su piel periódicamente para permitir su crecimiento y eliminar parásitos.

Similar Words

markedsøkonomi

Recent Searches

kalimutanedsashinesbangkokontingmaideachbigongambagcubiclepamanattacksolidifyeffectcertainconvertingrequiresupportexplainnagkitavirksomheder,kumembut-kembotmagta-trabahotaga-nayonpinakamatabangkagandahagnagtitindapinakamagalingspiritualnakapagreklamomakapangyarihangmedligayahoundmagkaibangnagmistulangnageespadahanmiradadalawintatlumpungmonsignornagtatanonglumiwanagpapanhikhila-agawanmagkaparehomalii-rechargenaliwanaganibinilimananakawmagkaharapnaulinigannapipilitanisinagotfranciscokaramihankakutissenadorhumalokumaenhinilahierbaspang-araw-arawdisensyosakyantungotumingalakesopabigatnaliligobukasathenagustongairplanesipinansasahognagwikangnakainfavormusicalpinaulananlangkaybagongnapilitangnagdaoslabahinnatayohuertohinukaymahigpitwaiterpinalayaspakisabimatayogmaisipmonumentosumimangotganangnaturalmagkamalinagpabakunazoostruggledmagisingrevolutionizedlegacymagtipidmatapospanindangbalangjoenaghihinagpisdipangredigeringsentenceiiklioperahannangshutsumakayindiamarahaspinalutohayabanganpagsisisikamatisroomasularghcenterpanaycanadabutihingresortroboticabstainingmalabolinelackproblemamasdanmajorinterestnatingalahinogdelecontinueslockdowntipidbabainiwannuclearcondoeyedidmandirigmangphilippinerelevantsmallclassmatebroadcastshimigmaputicreationformgenerationsmagingdagatgumagamitpakibigaynakabaonpalagiimbesgusalisugatanpalamutifacultykomunikasyonsabinagdaraantumaposkasoykayoeleksyonmaarinyoallergyspentnamamanghatravelerpakinabanganunahinyoutube,kinalakihanmagsasalitatransmitidasmahiwagangpatongmaniwala