Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "english"

1. He has improved his English skills.

2. He teaches English at a school.

3. I am not teaching English today.

4. I am teaching English to my students.

5. I have been studying English for two hours.

6. Paki-translate ito sa English.

7. She has been teaching English for five years.

8. The most famous professional football league is the English Premier League, followed by other major leagues in Europe and South America.

9. They have studied English for five years.

Random Sentences

1. When the blazing sun is gone

2. Ayos ka lang ba mahal ko, bakit parang namumutla at namamayat ka? tanong ng binata.

3. La science des matériaux est utilisée dans la fabrication de nombreux produits de la vie quotidienne.

4. Fødslen kan føre til hormonelle og følelsesmæssige ændringer, så det er vigtigt at tage sig af sin mentale sundhed.

5. Omelettes are a popular choice for those following a low-carb or high-protein diet.

6. I have been learning to play the piano for six months.

7. Representatives are accountable to their constituents, who have the power to elect or remove them from office through elections.

8. "Malapit nang dumating ang bagyo, maghanda na kayo," ani ng weatherman sa telebisyon.

9. O sige, ilan pusa nyo sa bahay?

10. Naghahanap ako ng mga chord ng kanta ng Bukas Palad sa internet.

11. Endvidere er Danmark også kendt for sin høje grad af offentlig velfærd

12. Medarbejdere skal overholde arbejdstider og deadlines.

13. Mahirap bilangin ang mga bituin sa langit.

14. Namatay ang mga pananim at ang tanging natira ay ang mga lasong puno na hitik na hitik sa bunga.

15. Después del nacimiento, la madre necesitará tiempo para recuperarse y descansar, mientras que el bebé necesitará atención constante y cuidado.

16. Bakit siya pa yung kelangan mong pahirapan?

17. Sa gitna ng laban, nagbabaga ang determinasyon ng boksingero na manalo.

18. Orang Indonesia memiliki beragam tradisi dan budaya dalam melakukan doa.

19. Sa tabing-dagat, natatanaw ko ang mga isda na lumilutang sa malinaw na tubig.

20. Inakalang masaya siya, pero sa likod ng ngiti ay may lungkot.

21. Groups on Facebook provide spaces for people with shared interests to connect, discuss, and share content.

22. The 10th Amendment of the Constitution outlines this division of power, stating that powers not delegated to the national government are reserved for the states

23. It is essential to approach the desire for a baby with careful consideration, as it involves lifelong responsibilities and commitments.

24. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

25. Bilang paglilinaw, ang ating proyekto ay hindi pa tapos kaya hindi pa ito maaaring ipasa.

26. Sometimes all it takes is a smile or a friendly greeting to break the ice with someone.

27. Ano ang pinapakinggan mo sa radyo?

28. Les hôpitaux peuvent être surchargés en période de crise sanitaire.

29. The United States is a culturally diverse country, with a mix of ethnicities, languages, and religions.

30. Ibinili nya ng maraming diaper ang kanyang anak.

31. The website's user interface is very user-friendly and easy to navigate.

32. Paano daw siya natalo ng isang matanda na mahina na ang mata at uugod-ugod pa.

33. Setiap tantangan membawa pelajaran berharga yang dapat digunakan untuk menghadapi tantangan berikutnya.

34. I am enjoying the beautiful weather.

35. Ang daming kuto ng batang yon.

36. Market indices such as the Dow Jones Industrial Average and S&P 500 can provide insights into market trends and investor sentiment.

37. Baket? Gusto mo na ba akong umuwi? balik tanong niya.

38. Hay una gran cantidad de recursos educativos disponibles en línea.

39. La fotografía es una forma de arte que utiliza la cámara para capturar imágenes y expresar emociones.

40. People experiencing baby fever may find themselves daydreaming about pregnancy, childbirth, and the joys of raising a child.

41.

42. Ang pagtitiyaga sa pagbabayad ng utang ay magdudulot ng kapanatagan sa buhay at magpapalakas ng financial stability.

43. Si Jeny ay bigong manalo bilang presidente ng kanilang paaralan.

44. Nakangiting tumango ako sa kanya.

45. Kabilang na roon sina Lala, Dada at Sasa.

46. Environmental protection is essential for the health and well-being of the planet and its inhabitants.

47. Pinagpalaluan ng mga empleyado ang kanilang manager dahil sa kanyang mahusay na pamumuno.

48. She lost her job, and then her boyfriend broke up with her. That really added insult to injury.

49. Nilalakad namin ang mapa para mahanap ang aming pupuntahan.

50. A lot of people volunteer their time and resources to help those in need.

Similar Words

nageenglish

Recent Searches

franciscopaglingonenglishsinkstillartistsgodmanamis-namiswealthandynasunogpangingimiaywanmatindingkinakailanganrobertnapatinginnapakagandapagbabayadochandonapakagagandanag-iisangpetsabroughtkargahanalayhukaypapagalitanluboslumuwaszooallowedcandidatenawalapagkatakoteksaytedpumulotburdenpumuntanatingalatabingpangungutyawritesequemakilingamendmentsbrancheseasynyastyrernapapatinginjoemasaksihanwebsitepangkatnapilingkinissmakainrestaurantdecreasedkakainhusoinilagaymainitstudiedknowledgebulalassocialeenglandelijegalitrenombrelender,maghintaykinabubuhaykinainnatuloypantalonlinggongmangkukulamhiwagapinagkakaabalahanaddictiondyipanilabumalikbluemalayangnaglalakadalas-dosebowputihikingbasahantsonggophysicalevenfollowing,ticketfeedback,maliksiabotkaninasangkapprivatemag-iikasiyamlandasbiocombustiblesofteenergicongratslendmagkakagustocallernoelipipilitnaabotalamidkiloearnsasayawindaigdigaccederriegaumibigt-isaencounterbarongbeautifulkinamagkasakitmataaspaliparinramdamnarinigkumampiritobingonalakibantulotmonetizingfireworkskabuhayanfallapresleyadditionallyestasyonnakarinigrailwaysnapasubsobpumuslitestablishlamangheartbeatdemocraticeroplanonananalongeconomybubongwishingtangeksrenatodoktorskirtdulanowtwitchpetsangbinibilangasawajuanmagsugalmatagumpaymakinangpandidiriminamadaliwatawatelenalarrymalapadlittlemakidalosinehanmartialnamulatrabeproyektoitinalipalipat-lipatanimmagamotmentalkatapatromanticismoanayhadnaka-smirknagtungopdanilaos