Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

10 sentences found for "quickly"

1. Basketball requires a lot of physical exertion, with players running, jumping, and moving quickly throughout the game.

2. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

3. He returned to the United States in the late 1950s, and quickly established himself as a leading figure in the martial arts community

4. His first hit, That's All Right, was released in 1954 and quickly climbed the charts

5. Leukemia can be acute or chronic, depending on how quickly the disease progresses.

6. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

7. The momentum of the train caused it to derail when it hit a curve too quickly.

8. The telephone has also played an important role in politics, as it has made it possible for leaders to communicate quickly and easily

9. The telephone quickly caught on, and by 1878, Bell's company, the Bell Telephone Company, had more than 50,000 subscribers

10. We need to get this done quickly, but not by cutting corners.

Random Sentences

1. The uncertainty of the future can cause anxiety and stress.

2. Accepting the job offer without reading the contract was a risky decision.

3. Los agricultores pueden aprovechar la tecnología para mejorar sus prácticas y aumentar su producción.

4. Peter Pan takes children on an adventure to Neverland, where they never grow up and encounter pirates and fairies.

5. Hashtags (#) are used on Twitter to categorize and discover tweets on specific topics.

6. He developed the theory of relativity, which revolutionized our understanding of space, time, and gravity.

7. Gracias por tu amabilidad y generosidad.

8. Hirap sa inyo ay sabad kayo nang sabad, e, sabi ng pulis

9. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

10. ¿Cómo te va?

11. Mens online gambling kan være bekvemt, er det også vigtigt at være opmærksom på de risici, der er involveret, såsom snyd og identitetstyveri.

12. Nahuli ang magnanakaw ng mga sibilyan at iniharap ito sa mga pulis.

13. Ang talakayan ay ukol kay Dr. Jose Rizal at sa kanyang mga kontribusyon sa bansa.

14. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

15. Napahinto kami sa pag lalakad nung nakatapat na namin sila.

16. El maíz necesita mucha agua para crecer y producir una buena cosecha

17. Sa pamamagitan ng pag-aaral ng kasaysayan, mas naging malalim ang aking kamalayan sa mga pangyayari noong panahon ng Digmaang Pandaigdig II.

18. La conciencia es la voz interior que nos guía hacia lo correcto y lo incorrecto.

19. The belief in God is widespread throughout human history and has been expressed in various religious traditions.

20. La foto en Instagram está llamando la atención de muchos seguidores.

21. Hendes smil kan lyse op en hel dag. (Her smile can light up an entire day.)

22. Les personnes ayant des motivations différentes peuvent avoir des approches différentes de la réussite.

23. Der er ingen grund til at skynde sig. Vi kan tage det roligt. (There's no need to hurry. We can take it easy.)

24. Kapag mayroong sakit sa ngipin, kailangan mong magpakonsulta agad sa dentista.

25. Ang batang matuto, sana sa matanda nagmula.

26. Bien que le jeu puisse être amusant et excitant, il est également important de se rappeler qu'il peut avoir des conséquences négatives s'il n'est pas géré de manière responsable.

27. Bigla nya akong hinigit sa kwelyo, Anong sinabi mo?

28. The objective of football is to score goals by kicking the ball into the opposing team's net.

29. Pinaoperahan namin siya, naging matangumpay naman ang operasyon, ngunit hindi na ito kinaya ng kanyang katawan.

30. I have been swimming for an hour.

31. Sumagot agad si Kuya isang ring pa lang.

32. Kinilig ako pero di ko pinahalata, whatever.

33. Patawarin niyo po ako, nagpadala ako sa mga pagsubok.

34. Nakatulog ako sa klase at nagitla ako nang biglang sumigaw ang guro sa aking tenga.

35. Más sabe el diablo por viejo que por diablo. - Age and experience trump youth and cleverness.

36. Ultimately, the concept of God is deeply personal and subjective, with each person's beliefs and experiences shaping their understanding of the divine.

37. Ano ang pinag-aaralan ni Cora?

38. Instagram also supports live streaming, enabling users to broadcast and engage with their audience in real-time.

39. She started a TikTok account to showcase her art and gain more exposure.

40. The Easter Island statues, known as Moai, are a mysterious wonder of ancient stone sculptures.

41. Matagal din bago napawi ang paninigas ng kanyang pigi.

42. Ang aso ni Lito ay kulay puti.

43. Hindi natin maaaring iwan ang ating bayan.

44. Tumagal ng ilang minuto bago natapos ang palabas.

45.

46. She had a weakened immune system and was more susceptible to pneumonia.

47. Sa kaibuturan ng kanyang puso, alam niya ang tama at mali.

48. Después de la entrevista de trabajo, recibí la oferta de empleo.

49. Pneumonia can be life-threatening if not treated promptly.

50. Les patients peuvent être hospitalisés pour une durée variable en fonction de leur état de santé.

Recent Searches

bloggers,quicklypilingfeedbackbahaingatanundasmalalimexcusetubig-ulanmauntogasimpangingimidagokkumalasnamintransport,paninigasbagamatkutodkakuwentuhangonebasuragradmadulaselectionsbinibiniginoongknowledgecomputerkasoguiltypapalapitcharismaticpamagatantonioninamakatulongforeverbeenvideonamulaklakvidenskabenmarketplaceshigupinnag-poutbagaypagkuwahagdanantinaymilafilipinonagniningningmahiwagaflynakakapuntaheldinaliskubobandanasundoinfectiousnatutulogburgernakabasagmeaningmanuscriptdettenutrientesstoplightginagawabinawianadvancemabatongpublicationadvertising,streetvehiclesrequirebentangtasaalbularyoresultmalezamatalinolangkaybiglapinapakingganiwanbiyaspinagmamasdannahihiyangnapakahangabalingtolmusmossumayamagdamagawitinkamustapinadalaibaliknakukuhakalarorebolusyonmaramiamuyinoktubrelaryngitisdumagundongpwestobakitdilawaga-agabakanagtungotradicionaldatakuwebaskyldes1982nagdalanakuhangnakatinginjulietpaglingadakilangnagkasalukuyanfilmgabi-gabidireksyonedsabrucetatawagnapapikitngpuntapatrickpagkatakotpambahaynapilingsiglatotoomabagalmuntikanpagsalakaymerrynamaherramientaagilitygasolinanothingpinakamaartengkinukuyomhospitalknow-howlumuwaspnilitcnicomarvinnitoopisinabrightmaligayapresyomatalimkinahaltnagpasamadaramdamincomplexhampastawalockedmasaksihanmimosaparangnaka-smirkdoble-karanangangahoyislandpalangoposuccessfulpayapangpamahalaanbigyanlumusobmadeaabsentvigtigstebighaniingaynapatigilmalilimutinarbejdsstyrkecosechacoachingraberobert