Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

3 sentences found for "either"

1. The fillings are added to the omelette while it is still cooking, either on top or folded inside.

2. The number you have dialled is either unattended or...

3. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

Random Sentences

1. Al que madruga, Dios lo ayuda.

2. Nagitla ako nang biglang nag-crash ang kompyuter at nawala ang lahat ng aking trabaho.

3. Naglalaro kami ng 4 pics 1 word sa cellphone.

4. Nabasa mo ba ang email ko sayo?

5. Maraming taong nakakalimot sa kababawan ng buhay dahil sa materyal na bagay.

6. Gaano ka kadalas kumain ng baboy?

7. Ang mainit na tasa ng tsokolate ay animo'y nagbibigay init sa malamig na gabi.

8. The United States has a system of federalism, where power is divided between the national government and the individual states

9. He appointed three Supreme Court justices during his presidency, shaping the ideological balance of the court.

10. Pinadala na nya ang kanyang resignation letter sa pamamagitan ng email.

11. The management of money is an important skill that can impact a person's financial well-being.

12. Napakaganda ng mga pasyalan sa bansang Japan.

13. Umihip ang malamig na hangin, waring may paparating na masamang balita.

14. Nangangaral na naman.

15. Si Jose Rizal ay napakatalino.

16. Nami-miss ko na ang Pilipinas.

17. Las vacaciones de invierno son un momento para descansar y pasar tiempo en familia.

18. Pasensya naman, anak rubber shoes ako eh.

19.

20. It is often characterized by an increased interest in baby-related topics, including baby names, nursery decor, and parenting advice.

21. The company's profits took a hefty hit after the economic downturn.

22. I don't want to cut corners on this project - let's do it right the first time.

23. Saka dalawang hotdog na rin Miss. si Maico.

24. He developed the theory of relativity, which revolutionized our understanding of space, time, and gravity.

25. Investing in the stock market can be risky if you don’t do your research.

26. Riega el maíz regularmente y asegúrate de que el suelo esté siempre húmedo

27. Les personnes âgées peuvent être sujettes à des chutes et d'autres accidents.

28. Biglaan siyang nagsalita nang hindi ko inaasahan na magkakaroon siya ng ganung opinyon.

29. I woke up early to call my mom and wish her a happy birthday.

30. The charitable organization provides free medical services to remote communities.

31. Another example is a decision tree algorithm, which is used to make decisions based on a series of if-then statements.

32. Ano-ano ang mga projects nila?

33. I know I'm late, but better late than never, right?

34. Online gambling er blevet mere populært i de seneste år og giver mulighed for at spille fra komforten af ens eget hjem.

35. Sa kaibuturan ng kanyang puso, alam niya ang tama at mali.

36. Nagtatrabaho ako sa Youth Center.

37. La menta es una hierba refrescante que se utiliza en bebidas y postres.

38. Tuwing Chinese New Year, nagtutungo ang mga tao sa mga templo upang magbigay-pugay.

39. Nakaramdam na lang ako biglang may humampas ng ulo ko.

40. Lumuwas si Fidel ng maynila.

41. He will always be remembered as a legend who brought martial arts to the mainstream and changed the way the world looked at martial arts forever

42. Nagpalipad ng saranggola si Juan sa bukirin.

43. Kinakabahan ako para sa board exam.

44. Madalas na mayroong mga organisasyon na nagsusulong ng kapayapaan at pagtigil ng digmaan.

45. The level of sweetness can vary in different types of sugar and sweeteners.

46. May problema ba? tanong niya.

47. Malamig sa Estados Unidos kung taglagas.

48. Smoking can be harmful to others through secondhand smoke exposure, which can also cause health problems.

49. Ang pangamba ay maaaring maging dahilan ng pagkakaroon ng stress at pagkalungkot.

50. Nació en Caprese, Italia, en 1475.

Recent Searches

eitherunti-untinggospelexigentevivanagsusulatmissiondiinamericapisnginagta-trabahoejecutansumasaliwcompartenfistsreturnedbehaviorcontinuespagpanhiktaosjannaniniwalabagamatnasunogsasamahanwaringganappamanhikannagpapasasakapatawaranpupuntahanmagtataaslarangandumaanlayasmayroonclientspoorermagta-taxikwebanglilikolever,milyongbairdnalangnaglulusakmainstreamtinulak-tulakmaestropinagbigyanubonakauwiwithoutcomplexexplaininfinityallowedpackaginghalosnaramdamanhabangnanlilimahidnakakitamag-asawangpalipat-lipatyouthnagsmiletumalimmanatilitumahanproductividadeskwelahanmakikipagbabagnamulatkasaganaanmagnakawsagotpagdudugohumaliknangahaspaghaharutanpagkuwakinikilalangnakapagproposepakikipaglabanalas-dosparisukatmanirahannapuyatkaano-anoulitstocksriyanbestidaphilippineapologeticbefolkningenorkidyasbintananatanongnaglutodumalonapakabiglaanmetodiskhinagismabibingipagongyelosakimnapagodtodasnahulogkayosirasignwashingtonpadabogadobosikocontestomelettebatoexcuseweddingmaluwanggabingingatanpalapitnapatingalascottishsumagotchoicevideosumasambawordsbatibobomerefurtherapphadadddulatabimatatagnahihiyangbusrefersellasatisfactionlulusogdedication,pa-dayagonalmahigpittaonmaibigaymallnilalanggamebisig1954abalavocalgreatmarinigpang-isahanglumingoncenterkagipitanencuestaseconomynagmakaawapunongkahoymagbabakasyondefinitivofulfillmentsementeryosuccessfulnakatinginglaybrarithankleftrightmatangallottedkoreamaya-mayabroadnegro-slavesbeyondtipstandpinilingkikohabitmiyerkulespalamutibethslave