Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

3 sentences found for "either"

1. The fillings are added to the omelette while it is still cooking, either on top or folded inside.

2. The number you have dialled is either unattended or...

3. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

Random Sentences

1. Maarte siya sa kanyang kagamitan kaya hindi siya nagpapahiram ng kanyang mga bagay.

2. Olympic athletes demonstrate incredible dedication through years of rigorous training and sacrifice.

3. La realidad puede ser cambiante, debemos ser flexibles y adaptarnos.

4. She is not designing a new website this week.

5. Les patients sont suivis de près par les professionnels de santé pour s'assurer de leur rétablissement.

6. Sayang, jangan lupa untuk makan malam nanti. (Dear, don't forget to have dinner tonight.)

7. Claro que te apoyo en tu decisión, confío en ti.

8. Les robots dotés d'intelligence artificielle peuvent effectuer des tâches répétitives et dangereuses pour les humains.

9. Different religions have different interpretations of God and the nature of the divine, ranging from monotheism to polytheism and pantheism.

10. Sa pagsasagawa ng outreach program, ang bayanihan ng mga organisasyon ay nagdulot ng pag-asa at pag-asa sa mga benepisyaryo.

11. The invention of the telephone led to the creation of the first radio dramas and comedies

12. Las plantas carnívoras son capaces de atrapar y digerir insectos u otros pequeños animales para obtener nutrientes adicionales.

13. Hay una gran variedad de plantas en el mundo, desde árboles altos hasta pequeñas flores.

14. Ailments can be a result of lifestyle choices, such as smoking or excessive alcohol consumption.

15. Hang in there."

16. The cat was sick, and therefore we had to take it to the vet.

17. Nasaktan, nagalit din ang lola at gumanti.

18. In conclusion, making a book is a creative and fulfilling process that requires planning, research, and hard work

19. Siya ay laging nagmamalabis sa pag-aaksaya ng pera para sa mga luho.

20. A través de la música, las personas expresan sus emociones, comparten sus historias y conectan con los demás

21. Gusto ko na talaga mamasyal sa Singapore.

22. Scientific research has led to the development of life-saving medical treatments and technologies.

23. Nagsisilbi siya bilang guro upang ituro sa kanyang mga estudyante ang tamang edukasyon.

24. Ngunit hindi inaasahang ang dadalaw pala sa kanya ay ang kanyang ama

25. Sinubukan niyang salatin ang pader sa dilim upang makahanap ng pinto.

26. La persona ebria en la calle está llamando la atención de los transeúntes.

27. No puedo dejar de dar las gracias por todo lo que has hecho por mí.

28. Sa trapiko, ang mga traffic lights at road signs ay mga hudyat na nagbibigay ng tagubilin sa mga motorista.

29. I am reading a book right now.

30. Eine hohe Inflation kann die Wettbewerbsfähigkeit von Exporten verringern.

31. Presley's influence on American culture is undeniable

32. Ang pag-asa ay nagbibigay ng inspirasyon sa mga tao upang magbigay ng tulong at suporta sa ibang tao.

33. Hindi niya napigilan ang pagdila sa kanyang labi nang naglalaway siya sa pagkaing inihain sa kanya.

34. Nació en Caprese, Italia, en 1475.

35. She has written five books.

36. Les programmes d'études sont élaborés pour fournir une éducation complète.

37. Ang tubig-ulan ay tumutukoy sa ulan na mayaman sa tubig at mahabang tagal.

38. Maganda ang kulay ng mga puno sa panahon

39. Cancer awareness campaigns and advocacy efforts aim to raise awareness, promote early detection, and support cancer patients and their families.

40. L'enseignement est un métier noble qui consiste à transmettre des connaissances aux élèves.

41. Ang pangalan ni Rizal ay itinuturing na sagisag ng pambansang identidad at paglaya sa Pilipinas.

42. Di pa namin napapag-usapan yan 'My.

43. The car broke down, and therefore we had to call for roadside assistance.

44. La internet ha cambiado la forma en que las personas acceden y consumen información en todo el mundo.

45. "Dogs are not our whole life, but they make our lives whole."

46. Huwag po, maawa po kayo sa akin

47. Ang pakikinig sa mahinahong agos ng ilog ay nagbibigay sa akin ng isang matiwasay na pakiramdam ng kalma at katahimikan.

48. Pede bang dito ka na lang sa tabi ko matulog?

49. Nationalism can inspire a sense of pride and patriotism in one's country.

50. Les riches dépensent souvent leur argent de manière extravagante.

Recent Searches

eitherspreadheihelpfulgitarastartedcompletenapatawagpanigpinagtatalunankwenta-kwentanakayukopahahanappagkainisnangyarikahuluganmagsusuotnahigitanumiisodlaruinrektangguloginamitnaabotmatumaltagpiangngitikartongkauntiairplanesnabiglapanunuksonakikitahumpaytenga3hrssakopdalawangsundaetransportationanongsinamatikmankagandahiningiexhaustedmulighedernicofurcanada1787paromorenasystematiskexammaitimstaplekainmagkasinggandalackmorekriskacigarettesdalandanwalisreleasedmapapafacelayout,rightitemsguidegapcertainissuesbarungbarongbiocombustiblesnagbiyayanakaririmarimpamanhikanhinawakanpagkatakotmahahalikselebrasyonnagbagoinagawkatutubonasunogtelabihirangnaalisgigisingheartbeatumalislazadapalakabusogmasktwitchpacienciasufferdiagnosticisipproperlyumingitearnkasinggandacongratsmisusedanothereverymapadaliseparationsambitbroadcastingmakikipag-duetohumalakhakbibisitanasasabihaninterests,lalabhannaglulutokinahuhumalingannakatapatnagdalapakiramdamnagbabalaandroidpunongkahoymanakboiligtaslucyguidancemariemawalasikotsuperdesarrollarsinagotmournedopisinapepefurybalingreloclockellenreducedipinailingmaratinglabananpaskongyeahdatasourcesalemaihaharapmanggagalingpamamasyalmusicmagpalagobefolkningen,nahintakutanriquezabinuksannangapatdanilalagaytumalonflamencopasahemangingisdangmaibamalakiipapamananapakamotpinalambotluboslugawpokerpagdamiauthornilapitankenjikainisnararapatanyodollardependkontinghverlenguajemanghuliwalongbigotesumakityeppagodmasarapnapapadaanhumanos