Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

3 sentences found for "either"

1. The fillings are added to the omelette while it is still cooking, either on top or folded inside.

2. The number you have dialled is either unattended or...

3. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

Random Sentences

1. The telephone has also had an impact on entertainment

2. They have been studying math for months.

3. Sweetness is a sensation associated with the taste of sugar and other natural and artificial sweeteners.

4. All these years, I have been discovering who I am and who I want to be.

5. Cigarettes made of tobacco rolled in tissue paper helped spread a very harmful habit among the so-called advanced countries of the West

6. Hindi pa rin siya lumilingon.

7. Salamat sa iyo kaibigan, nailigtas mo ako sa kamay ng itim na salamangkera.

8. Den danske økonomi er bygget på en kombination af markedsekonomi og offentlig regulering

9. The company’s momentum slowed down due to a decrease in sales.

10. En resumen, la música es una parte importante de la cultura española y ha sido una forma de expresión y conexión desde tiempos ancestrales

11. Pilit mang hinila ng prinsipe ang kamay ay di nito magawang makawala sa pagkakahawak ng prinsesa.

12. Einstein was offered the presidency of Israel in 1952, but declined the offer.

13. Additionally, television has also been used as a tool for educational programming, such as Sesame Street, which has helped to teach young children reading, writing, and math

14. Samantala sa kanyang pag-aalaga sa mga alagang hayop, nae-enjoy niya ang mga simpleng kaligayahan na hatid ng kanilang kakaibang personalidad.

15. Buksan ang puso at isipan.

16. Helte kan have en positiv indflydelse på hele samfundet.

17. Napatingin ako sa orasan. 12 na ng madaling araw.

18. Tumayo ako para tingnan yung itsura ko ngayon.

19. Nag-aalinlangan ako sa aking desisyon dahil sa aking mga agam-agam tungkol sa magiging epekto nito sa aking pamilya.

20. They are singing a song together.

21. Lapat na lapat sa kanya ang kamisetang iyon noong bagong bili ngunit ngayo'y maluwag na.

22. Mi aspiración es ser una persona más compasiva y empática hacia los demás. (My aspiration is to be a more compassionate and empathetic person towards others.)

23. Mayroong mga bayani na hindi kilala ngunit nagawa nilang magpakumbaba at maglingkod sa bayan.

24. Magdidisko kami sa makalawa ng gabi.

25. Det er vigtigt at have et støttende netværk af venner og familie under fødslen og i de første måneder efter fødslen.

26. The scientist conducted a series of experiments to test her hypothesis.

27. Muchas serpientes venenosas poseen colmillos huecos a través de los cuales inyectan veneno en sus presas.

28. Durante las vacaciones, disfruto de largos paseos por la naturaleza.

29. "Tuloy po kayo," ani ng matanda sa bisita niyang dumating.

30. Ang mga dragon at lion dance ay karaniwang makikita sa mga kalye tuwing Chinese New Year.

31. The Parthenon in Athens is a marvel and one of the most famous wonders of classical Greek architecture.

32. No puedo controlar las acciones de los demás, solo puedo aceptarlas con "que sera, sera."

33. Gusto ko na talaga mamasyal sa Japan.

34. He is not driving to work today.

35. Wives can be loving, supportive, and caring companions to their spouses.

36. Les employeurs peuvent utiliser des méthodes de travail flexibles pour aider les travailleurs à équilibrer leur vie professionnelle et personnelle.

37. El agua es el recurso más preciado y debemos conservarlo.

38. The football field is divided into two halves, with each team playing offense and defense alternately.

39. A pesar de su mala reputación, muchas serpientes son inofensivas para los seres humanos y desempeñan un papel crucial en la naturaleza.

40. He believed that martial arts was not just about physical skills, but also about mental and spiritual development

41. Sa bawat panaghoy ng mga nagugutom, pilit nilang itinataguyod ang kanilang pamilya.

42. My grandma called me to wish me a happy birthday.

43. Laganap ang fake news sa internet.

44. Maglalaro ako ng tennis. Ikaw?

45. Scissors have handles that provide grip and control while cutting.

46. The king's subjects are the people who live in his kingdom and are under his rule.

47. Mi aspiración es trabajar en una organización sin fines de lucro para ayudar a las personas necesitadas. (My aspiration is to work for a non-profit organization to help those in need.)

48. Foreclosed properties are often sold at a discounted price, making them an attractive option for real estate investors.

49. May nagbigay sa amin ng biglaang free food sa opisina kanina.

50. Huwag kang mag-focus sa kababawan ng isang tao, tingnan mo ang kanyang kalooban.

Recent Searches

gapinaapithreeeithercallingeffectseditortechnologyincreasesamazonelectinfinityplatformtechnologicalmasterayanmitigatelargeviewryanmakingpackagingroughreallyawareincreasecableandyamountnutsgenerabaworkingdraft,termmenubasacountlessalignsservicesanotherelectedmakestechnologiesuniqueinternalenterinternacirclemaratingbakasyonexhaustionhjemsteddevelopprogrammingstringknowledgedevelopmentformsattacksourcenapilingefficientincludebituincontinueinsteadautomaticbinilingcreatejunjunitemspatrickneedsshiftsolidifyprogramming,effectevolveevolvedvisualformatentryinteractablecuandocertainexistbetweentwopublishedguidecontrolaemphasizedrequirefuturestyrerremembertabaexplaineditdifferentintroducenakalagaysanamaghapongayokobellmatuloginiwanbutcheventoshugisnanayhmmmtagalognavigationmangeiconiceverythingsanggolvoresmaalwangbansangumaagosofrecenmanuksomalayangdahonwalissaudipunsopagsumamovelstandmapahamaknaggalamansanasgoshupangregularmenteikinakagalitnapakagandangnageenglishmanamis-namisthoughtsbiglalintamagkasintahanposporonakagalawmagkakaanaknakikilalangtinulak-tulakmagtatagalspiritualnagliliyabnagmamaktolnakapagreklamonapakatagalkinamumuhianpagka-maktolmoviesginugunitatuluy-tuloynaglalatanggayundinpinagtagponakabulagtangnagsusulatnagliliwanagkakuwentuhanmagkahawakkasawiang-paladnagkitanangagsipagkantahannakakapamasyalpalipat-lipatkalalakihannakaramdampinakamaartengnaguusapnagtatrabahopinagmamalakiculturanamumukod-tanginakukuhakumukuhanagkakatipun-tiponoktubrenapakamisteryosolitsonabolinebirdselectoralklasengbarriershelpedutak-biyatatayonag-aabang