Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

3 sentences found for "either"

1. The fillings are added to the omelette while it is still cooking, either on top or folded inside.

2. The number you have dialled is either unattended or...

3. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

Random Sentences

1. Work can also provide opportunities for personal and professional growth.

2. Los invernaderos permiten el cultivo de plantas en condiciones controladas durante todo el año.

3. Los Angeles is home to prestigious universities like UCLA and USC, attracting students from around the world.

4. Hindi madaling mahuli ang mailap na pag-asa.

5. Ang pinakamalapit na lugar na kanilang narating ay mababa pa rin ang altitude.

6. With dedication, patience, and perseverance, you can turn your manuscript into a finished book that you can be proud of

7. Gaano kalaki ho ang gusto niyo?

8. Bibigyan ko ng cake si Roselle.

9. El internet ha hecho posible la creación de comunidades en línea alrededor de intereses comunes.

10. The clothing store has a variety of styles available, from casual to formal.

11. Pakibigay ng tubig sa mga trabahador sa labas, mukhang nauuhaw na sila.

12. The versatility and precision of oscilloscopes make them indispensable tools for electronic design, testing, and research.

13. Don't spill the beans about the project, it's supposed to be a secret.

14. Bumagsak ang dilim sa kalsada ng biglaan kaming tumama sa ilaw ng poste ng kuryente.

15. Nakapasa si Andrew sa pagsusulit.

16. Buti naman. Ayoko mahawaan ng kuto eh.

17. Magtanim ay di biro, maghapong nakayuko.

18. ¿Qué le puedo regalar a mi novia en el Día de San Valentín?

19. The new restaurant in town is absolutely worth trying.

20. Sa kabila ng lahat ng pagsubok na dumadating sa atin, ang mga kanta ng Bukas Palad ay patuloy na nagbibigay ng pag-asa at liwanag.

21. Pinagtabuyan ng mga mababangis na hayop at ng mga ibon ang kawawang si Paniki.

22. AI algorithms are computer programs designed to simulate intelligent behavior.

23. Dito ang mga lalaki at doon ang mga babae.

24. Nagsisilbi siya bilang public servant upang matugunan ang pangangailangan ng kanyang nasasakupan.

25. Maghintay ka nang kaunti, sagot ng lola habang abalang nagta-trabaho.

26. The internet is full of April Fool's hoaxes and pranks - some are funny, but others are just mean-spirited.

27. Namnamin mo ang bawat subo ng masarap na ulam.

28. At noon, higit kailanman, naging hamak sila sa pagtingin ng lahat.

29. Puwede bang pahiram ng konting oras mo para mag-usap tayo?

30. In recent years, the telephone has undergone a major transformation with the rise of mobile phones

31. May isinulat na sanaysay ang isang mag-aaral ukol kay Gabriela Silang.

32. Madulas ang magnanakaw, ngunit nahuli rin siya ng mga naglalakad na sibilyan.

33. El parto natural implica dar a luz a través del canal vaginal, mientras que la cesárea es una operación quirúrgica que implica hacer una incisión en el abdomen de la madre.

34. La arquitectura es una forma de arte que se centra en el diseño y construcción de edificios.

35. Sa gitna ng kanyang pagbabasa, nabigla siya sa malakas na kulog at kidlat.

36. Kapag dapit-hapon, masarap mag-relax sa veranda habang nanonood ng sunset.

37. They have lived in this city for five years.

38. The bride and groom usually exchange vows and make promises to each other during the ceremony.

39. Emphasis can also be used to create a sense of urgency or importance.

40. Ang pulis ay nakabalik na sa outpost at sa isang ospital na tumatawag.

41. At leve med en god samvittighed kan hjælpe os med at opbygge stærke og tillidsfulde relationer med andre mennesker.

42. Las plantas proporcionan oxígeno y son esenciales para mantener el equilibrio ecológico.

43. Pakiluto mo nga ng pancit ang mga bata.

44. Ang lahat ng problema.

45. Forgiveness is a gift we give ourselves, as it allows us to break free from the chains of resentment and anger.

46. Kamu ingin minum apa, sayang? (What would you like to drink, dear?)

47. May konsyerto sa plasa mamayang gabi.

48. Ang mga magsasaka ay nagtatanim ng palay.

49. Dahil sa pagkabigla at pagkatakot, nagpasya ang matanda na tumakbo na lamang pauwi pero pinigilan siya ng diwata.

50. The uncertainty of the future can cause anxiety and stress.

Recent Searches

tarcilanariningeitherkuripotsamakatwidkatutuboworkshopnaglalaroabenaleopatidividesmatipunogamotsambitdoktordiyosnapapadaanbisitaumabotsasakaypanginoonumibigpunsobakalintapataylumayopangulomahihirapadditionlumikhaclassmatehoweversystemfallacompanykagayajunjuntayohumintopromiseadventpinagawaumiyakmanunulatpapaanoconditioningformanapilitangipatuloynaintindihantrabahohirammakakalimutinadversesaidmallmapapansinmasasabiemnersanggolotheruuwiakalaingcertaincasesskypemag-aralwishingpinatawadnakitangsubalitnapalakasika-12katabingpalancacelularesgalaandespitemagsaingmagigingmagpahabavelfungerendepiecesprocesobio-gas-developinglumamangburdenworrytagalogtoretepaskongtsaaevolucionadohellotinatawagkusinakarunungankatagangsportsweddingstoryeskuwelafitnessmagkaibiganbehindmaghihintayradiomamasyalkalayuandibdibparkenakalilipasnakukuhamag-plantipinambiliamparocandidatesfilipinanatitirangsnatradetinanggalnangahaspaglisanelenagasolinapaligsahanmagalangcapitalnasiyahaniskedyuleroplanoexperts,nanigaskagubatanhinabollondongreatlykulungankinahuhumalingansakafleremukhangrenatocultivationarbularyotatlonghagdananpakaininiindapagongde-latapinagkiskispinagparomaatimpagtatakaarturomakuhademocraticmagawalamanghumpaywatchmagbibiladpinaulananpamagatrealisticnuhpublishing,uripagsubokpaidmagpapagupitresumenlakibusloinabutanmakapaniwalaalamidipaliwanagiyangrewsumasayawdisyembremahiyanamakitpinagwikaanibiniliformassinehanrespektiveschoolsmasipagdi-kawasamakikipagbabagrito