Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

3 sentences found for "either"

1. The fillings are added to the omelette while it is still cooking, either on top or folded inside.

2. The number you have dialled is either unattended or...

3. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

Random Sentences

1. Después del nacimiento, el bebé puede ser amamantado o alimentado con fórmula, dependiendo de las preferencias de los padres y la salud del bebé.

2. Si Doming na nagkaroon ng kasintahan na maganda ay inagaw ng kanyang kaibigan

3. Dwyane Wade was a key player in the Miami Heat's championship runs and known for his clutch performances.

4. Ang carbon dioxide ay ina-absorve ng mga puno.

5. Cooking at home with fresh ingredients is an easy way to eat more healthily.

6. The widespread use of digital devices has led to an increase in sedentary behavior and a decrease in physical activity

7. Les travailleurs peuvent travailler de manière saisonnière, comme les agriculteurs.

8. I love the combination of rich chocolate cake and creamy frosting.

9. Si Juan ay nagiigib ng tubig mula sa poso para sa mga halaman sa hardin.

10. How I wonder what you are.

11. La seguridad y el bienestar de los agricultores y sus familias son importantes para garantizar un futuro sostenible para la agricultura.

12. Inflation kann zu einer Abwertung der Währung führen.

13. Einstein's most famous equation, E=mc², describes the relationship between energy and mass.

14. Les enseignants ont un impact majeur sur la vie des élèves et leur réussite scolaire.

15. Danau Toba di Sumatera Utara adalah danau vulkanik terbesar di dunia dan tempat wisata yang populer.

16. Nagliwanag ang buong paligid at naging abo ang katawan ni Matesa.

17. Si Maria ay mahusay sa math, datapwat hindi siya mahilig sa science.

18. Sang-ayon ako na importante ang pagpapahalaga sa ating kultura at tradisyon.

19. Mataas sa calcium ang gatas at keso.

20. Tingnan natin ang temperatura mo.

21. He is taking a photography class.

22. Dala ng malakas na pagdidilim, mas lalong nahirapan akong makita ang daan pabalik sa tahanan.

23. Huwag magpabaya sa pag-aasikaso ng mga responsibilidad sa tahanan o sa trabaho.

24. Las heridas en zonas sucias o contaminadas pueden aumentar el riesgo de infección y requerir una limpieza más exhaustiva.

25. Noong una, sinasagot niya ang mga panunuksong ito.

26. She does not use her phone while driving.

27. Sa panahon ng digmaan, madalas na nagkakaroon ng migrasyon at pagkawala ng mga tao sa kanilang tahanan.

28. Salah satu bentuk doa yang populer di Indonesia adalah sholat, yang merupakan salah satu rukun Islam.

29. Madalas lasing si itay.

30. Hinugot niya ang kanyang hininga bago siya sumagot sa tanong ng guro.

31. Sometimes it is necessary to let go of unrealistic expectations or goals in order to alleviate frustration.

32. Wow, talaga? Para kayong vampires, sa gabi nabubuhay.

33. Si Rizal ay nagbigay-inspirasyon sa maraming Pilipino na magkaroon ng katapangan at determinasyon sa kanilang pakikipaglaban para sa pagbabago at katarungan.

34. I'm sorry, I didn't see your name tag. May I know your name?

35. Facebook offers targeted advertising options for businesses and organizations to reach specific audiences.

36. Ang pangalan niya ay Mang Sanas.

37. Masayang-masaya siguro ang lola mo, ano?

38. Masipag manghuli ng daga ang pusa ni Mary.

39. Sa kasalukuyan, yumabong ang interes ng mga tao sa pagsasaka ng mga organic na gulay.

40. Siya ay isang masipag na estudyante na pinagsisikapan ang kanyang pag-aaral para makamit ang mataas na marka.

41. Paulit-ulit na niyang naririnig.

42. El realismo y el impresionismo son estilos populares en la pintura.

43. Hockey is known for its physicality, with players often engaging in body checks and other forms of contact during the game.

44. Los sueños nos inspiran a ser mejores personas y a hacer un impacto positivo en el mundo. (Dreams inspire us to be better people and make a positive impact on the world.)

45. Pumitas siya ng isang bunga at binuksan iyon.

46. Sigurado na siyang walang panalo sa kanya ang matanda.

47. Sa loob ng simbahan, natatanaw ko ang magandang retablo at mga banal na imahe.

48. Naiilang pa ako sa kanya dahil bago pa lang ako sa pagliligaw, kaya hindi ko alam kung paano siya lapitan.

49. Ang editor ay nagsusulat ng mga komento at mga pagsusuri sa mga akda ng mga manunulat.

50. Sa takip-silim, nakakapagbigay ng romantikong vibe sa mga tao.

Recent Searches

eitherpinalalayaskamalayandoble-karalumayomag-ingatdisciplinnilutooruganyaneksportererlot,incluirsystematisktinapaymaramipersonalhumakbangbangkaganidkaninamilyonglasingeroelectorallamesasadyangemailsumungawestardawmaitimbintanajannahapunanjoblalongloseksperimenteringmaulitadobopagkalapitpaghangamakukulaybaultiniktelefonakoano-anopag-akyatnag-emailanthonynanggigimalmalincidencepahiramt-ibangsoretshirtterminosinongkasibasalalakepasasaankalakihankalaunanydelsergayamaliitnapakalupalopsalitagitaramulanitomayana-curiouscreatedpasannaputolheartprinsipepag-aapuhapbotosagasaanlibaglabans-sorrykaragatanahhhhdancedadnananaghilipingganasagutantarangkahanhojas,klasengidiomanagtungokakuwentuhancupidnatutulogsaan-saanflightguitarrabakasyonuniversalwidengayonbiocombustiblespangungusapresultahinamakagwadorbaliwflexiblekirotmaaritvsunangtoybuhaynagagalitmanonoodnakatindigpamamalakadhabangnag-aagawanpalayanpintobumababasumalanathanphilanthropyannikamaluwagmakilinggenerabadoktorlipatpapuntachangedlockdowngagahinagispaghamaktsakadied1982likeshitikdaantraditionalcomuneslumusobpamilyatuladoncenangangalitmahiyasamfundpaanannawalamasayahinnapakaramingcardigankitangscalelandbarrocowikamamayadogkapalnutrienteskaliwangpumayagsiyamparticularnagbibigaygitnabahay-bahayinuminintsikstorypagkakalutolumakadkaniyanakakakuhanewkidkiranitimdalirikahitdarnapumapasokkaguluhanneaanonglarawan