Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

3 sentences found for "either"

1. The fillings are added to the omelette while it is still cooking, either on top or folded inside.

2. The number you have dialled is either unattended or...

3. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

Random Sentences

1. Pakain na ako nang may dumating na bisita.

2. Puwedeng gamitin ang pagguhit upang mag-drawing ng mga bagay na gusto mong ma-achieve sa buhay.

3. Ang bayanihan ay nagpapakita ng pagkakaisa at pagtutulungan sa pagharap sa mga hamon ng buhay.

4. The team's performance was absolutely outstanding.

5. The team's logo, featuring a basketball with a crown on top, has become an iconic symbol in the world of sports.

6. Bumili kami ng isang piling ng saging.

7. The job market and employment opportunities vary by industry and location.

8. Palibhasa ay may kakayahang magpakalma sa mga sitwasyon ng kaguluhan at kalituhan.

9. He plays chess with his friends.

10. Ang mga bayani ay nagbibigay ng pag-asa at magandang kinabukasan para sa mga susunod na henerasyon ng mga Pilipino.

11. The patient was advised to follow a healthy diet and lifestyle to support their overall health while undergoing treatment for leukemia.

12. Winning the championship left the team feeling euphoric.

13. Happy Chinese new year!

14. Puwedeng gamitin ang pagguhit upang magpahayag ng mga saloobin at mensahe sa mga taong mahal mo.

15. The cake was so light and fluffy; it practically melted in my mouth.

16. One April Fool's, my sister convinced me that our parents were selling our family home - I was so upset until she finally revealed the truth.

17. Nag-enjoy ako sa pag-aaral ng isang bagong wika kaya nahuhumaling ako sa pag-aaral ng iba pang wika.

18. Online traffic to the website increased significantly after the promotional campaign.

19. Ang kotseng nasira ay kotse ni Jack.

20. Bumibili ako ng malaking pitaka.

21. All these years, I have been creating memories that will last a lifetime.

22. Los héroes inspiran a otros a levantarse y luchar por lo que es correcto.

23. "Dogs come into our lives to teach us about love and loyalty."

24. Muchas serpientes venenosas poseen colmillos huecos a través de los cuales inyectan veneno en sus presas.

25. What goes around, comes around.

26. Elektronik kan hjælpe med at forbedre sundhedspleje og medicinsk behandling.

27. A new flyover was built to ease the traffic congestion in the city center.

28. Halos hindi niya narinig ang halingling ni Ogor.

29. The United States has a capitalist economic system, where private individuals and businesses own and operate the means of production

30. The elephant in the room is that the project is behind schedule, and we need to find a way to catch up.

31. Napakagaling nyang mag drawing.

32. Después de hacer ejercicio, me gusta darme una ducha caliente.

33. Nagkakasayahan sila sa isang panig ng bilangguan

34. Nang marating niya ang gripo ay tungo ang ulong tinungo niya ang hulihan ng pila.

35. Kapareha naman ni Kangkong ang Sitaw, ni Mangga ang Dalanghita, ni Saging ang Papaya.

36. Sweet foods are often associated with desserts, such as cakes and pastries.

37. Nangahas ang bata na tawirin ang ilog kahit hindi marunong lumangoy.

38. Baby fever can also be influenced by societal and cultural norms, as well as personal experiences and values.

39. Habang naglalakad, naisip niya na maganda ang ideya na lumibot sa paligid ng kanyang silid-aralan para makahanap ng inspirasyon.

40. She is not practicing yoga this week.

41. Hindi siya sumagot sa tanong ko, waring may iniisip siyang iba.

42. Tumango lang ako. Wala ako sa mood na magsalita.

43. If you want to maintain good relationships, don't burn bridges with people unnecessarily.

44. Nakatira ako sa San Juan Village.

45. Di Indonesia, pemerintah mendorong pembinaan nilai-nilai keagamaan yang inklusif dan menggalakkan semangat gotong royong berbasis agama.

46. Maraming mga uri ng droga, tulad ng marijuana, cocaine, heroin, at methamphetamine.

47. A couple of songs from the 80s played on the radio.

48. Lazada's parent company, Alibaba, has invested heavily in the platform and has helped to drive its growth.

49. Quiero ser una influencia positiva en la vida de las personas que me rodean. (I want to be a positive influence in the lives of people around me.)

50. The TikTok generation is reshaping the way we consume and create content, with short-form videos becoming the new norm.

Recent Searches

eithershortnalulungkotnaiilangnagpaiyakmagpaniwalanagbakasyonnakatunghaypahahanapdekorasyonkonsultasyonpagkaimpaktofilipinahouseholdsnalugmokhumahabanakatalungkomakabilingumiwimakakibouugod-ugodmakinginiindaintindihinmaintindihannaglulutovenusrespektivepagbabantanakainomunidosfederalbibilhintanyagmakakapansamantalaganidlunes1960sbalinganfriendssumigawkaarawantiningnanmrslandoanaymalayangstillcommunitysellsuccessfulpunsorobertratefansrhythmlasingero2001dinalastandpartnertomnahuhumalingnamumulaklaktradisyonmakapaibabawnagngangalangmassestinangkapagpapatubokasiyahangumagamitfranciscopahiramligayanalangmongretirarpakibigayvitaminmerchandiselayuanampliaburolwednesdaymisteryococktailnag-away-awayhappenedmartialnenapisonoblehetolateboyetbeganhanlarryyanhimselfeducationalbridemapakalientryalignskumukuhakayamangingisdangkinauupuanghurtigerepunung-punoalexanderunti-unticultivapaglalaitinilistayumabongmagbantaydatapwatganapinmauupoanumannandiyantagaldailylarongiyakhelpedkaysakulanginomcasabumabahaimaginationmalinisnakasuotniligawanpaghingifeedback,inisgodgamitmumuradidingcirclepagigingchefkategori,limitednagtatrabahonagre-reviewsimbahanlabormakukulaynagpasamagasmeneksport,napakomarilousumpainbumuhostamisupuanbinigyansalitangpinag-aralanhidingchickenpoxpagtutolspecializedgatheringmaranasanelectpaslitnanlilisikconsiderednaghihirappagsasalitatayonapakatagalnag-aalalangmarahilnapakasipaglabing-siyamshiftbulaklakbayawakinterests,tumalonsocialiyamotnaawacountrypangalanankanayangtalentednamumutlakung