Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

3 sentences found for "either"

1. The fillings are added to the omelette while it is still cooking, either on top or folded inside.

2. The number you have dialled is either unattended or...

3. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

Random Sentences

1. Diretso lang, tapos kaliwa.

2. We admire the dedication of healthcare workers in the midst of the pandemic.

3. Sinubukan niyang salatin ang pader sa dilim upang makahanap ng pinto.

4. Vivir en armonía con nuestra conciencia nos permite tener relaciones más saludables con los demás.

5. Investing in the stock market can be risky if you don’t do your research.

6. Microscopes can be used to study the structure and function of the brain and other organs.

7. Saan kami kumakain ng mami at siopao?

8. Bigyan mo ng pera ang kapatid mo.

9. Sueño con tener la libertad financiera para hacer lo que quiero en la vida. (I dream of having financial freedom to do what I want in life.)

10. Sa karagatan ay masusumpungan ang magagandang koral at mga isda.

11. Magaling magturo ang aking teacher.

12. He is not taking a walk in the park today.

13. El cambio de gobierno produjo una reorganización completa de las instituciones.

14. Da Vinci fue un artista renacentista muy importante.

15. Este año planeamos viajar a España durante las vacaciones de verano.

16. Lalong nagalit ang binatilyong apo.

17. Gusto mo ba ng isa pang tasa ng kape?

18. Nilinis namin ang bahay kahapon.

19. Sop buntut adalah sup yang terbuat dari ekor sapi dengan rempah-rempah dan sayuran yang kaya rasa.

20. Nice meeting you po. nag smile sila tapos nag bow.

21.

22. Es importante tener en cuenta que el clima y el suelo son factores importantes a considerar en el proceso de cultivo del maíz

23. Les riches dépensent souvent leur argent de manière extravagante.

24. Sayang, apakah kamu mau makan siang bersama aku? (Darling, would you like to have lunch with me?)

25. Natapos ko ang malaking proyekto na matagal ko nang inaayos kaya masayang-masaya ako ngayon.

26. Wedding favors are small gifts given to guests as a thank you for attending the wedding.

27. Who needs invitation? Nakapasok na ako.

28. Pupunta si Mario sa tabing-dagat sa hapon.

29. El agua cubre aproximadamente el 70% de la superficie del planeta.

30. He practices yoga for relaxation.

31. Instagram Stories is a feature that lets users share temporary photos and videos that disappear after 24 hours.

32. Las serpientes juegan un papel importante en el equilibrio de los ecosistemas al controlar las poblaciones de roedores.

33. Inakalang madaling matatapos ang proyekto, ngunit maraming komplikasyon ang dumating.

34. Hindi nya masikmura ang harap-harapang panloloko ni mayor sa kanyang nasasakupan.

35. Ininom ni Henry ang kape sa kusina.

36. Nang makita ang paparating na ulan, kumaripas ng uwi ang mga bata mula sa palaruan.

37. Las heridas en áreas articulares o que afectan nervios o vasos sanguíneos pueden requerir de intervención quirúrgica para su reparación.

38. Sumaya ang mundo ni kuya dahil sa iyo.

39. Shows like I Love Lucy and The Honeymooners helped to establish television as a medium for entertainment

40. May mga salarin na gumagamit ng iba't ibang modus operandi upang mabiktima ang mga tao.

41. Julia Roberts is an Academy Award-winning actress known for her roles in films like "Pretty Woman" and "Erin Brockovich."

42. She has been making jewelry for years.

43. Bakit ka nakitulog sa bahay ng kaibigan mo?

44. When I saw that Jake and his friends all had tattoos and piercings, I thought they might be a rough crowd - birds of the same feather flock together, right?

45. Ikaw pala, Katie! Magandang hapon naman.

46. At følge sin samvittighed kan være afgørende for at træffe de rigtige beslutninger i livet.

47. At følge sine drømme kan føre til stor tilfredsstillelse og opfyldelse.

48. He will always be remembered as a legend who brought martial arts to the mainstream and changed the way the world looked at martial arts forever

49. Palaging sumunod sa mga alituntunin.

50. Hang in there and stay focused - we're almost done.

Recent Searches

eitherreallynamungasetsbetaadaptabilityayankamabackpackpilingextrauniquewhichconvertidasapppotentialnalugodmagsasalitarailwaysbownamakartonpakibigay4thdaigdignaiinggiteffort,aidpreviouslybridedidingpasswordnagpalalimsayawanbukakapagdamimasasayamemorypinaginvestnaabutankabuntisangandahanmontrealguitarranakabasagdeliciosapunongkahoyalokmesangpresence,manghikayatpagkahapokinabubuhayenergy-coalpinagkiskisliv,hinimas-himastumingalakinukuhapagkakatuwaanbolalotpagngitiwalkie-talkiekakuwentuhannaka-smirktumawagpapanhiknakaramdamprovebiggestcharmingpagbahingtanimbinigyangtherapysubjectmapayapatahimikcompletingmamalasmagtakagawinlaruinkumakantanareklamopagsuboknagagamitkalakikuwentohulihannakilalakababayangnatabunanbakantecruznaiiritanglot,tekanariyanano-anobintanatalaganggalaannangingisaykasamaangsisikatcover,writing,platformsmartiansouthsandwichairplaneskumainbutterflyarturohihigitincrediblemaatimgloriaperseverance,turonrobinhoodanilainventionmaghintaycalidadnahahalinhanbinanggabumigaychoihabitperwisyofiverrreviewmayamangcarolhampaslupatinulak-tulakpinapakingganulapmakasarilingtoretecupidsyaleodinalawsuotflaviocelularessasakyanhelpfulcolourtaledividesmarkeddidfriesnuclearsurgeryprogramsissueswhyhalosplatformincludeincreasedthoughtsmakamitpayapangpaglalabamagasawangfilipinanagkapilatkamandagmagbibiladiniindamagsungitrespektivenakaraanpanghimagaspag-iinatmangungudngodnag-iyakantinapaynarinigumakyattamanggawabandapicsipinagbibilipunung-punodropshipping,auditpinagbigyanpetsadisciplin