Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

3 sentences found for "either"

1. The fillings are added to the omelette while it is still cooking, either on top or folded inside.

2. The number you have dialled is either unattended or...

3. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

Random Sentences

1. He tried to keep it a secret, but eventually he spilled the beans.

2. At være bevidst om vores handlinger og beslutninger kan hjælpe os med at undgå at skade andre og os selv.

3. I have an important interview today, so wish me luck - or, as they say in the theater, "break a leg."

4. Honesty is the best policy.

5. Diyos ko, ano po itong nangyayari sa aming anak?

6. Les enseignants doivent collaborer avec les parents et les autres professionnels de l'éducation pour assurer la réussite des élèves.

7. Women have shown remarkable resilience and strength in the face of adversity and oppression.

8. Mangungudngod siya, mahahalik sa lupa.

9. Transkønnede personer kan opleve diskrimination og stigmatisering på grund af deres kønsidentitet.

10. Aplica abono orgánico al suelo para proporcionar nutrientes adicionales a las plantas

11. Si Josefa ay maraming alagang pusa.

12. Nasaan ang Ochando, New Washington?

13. Das Gewissen kann uns helfen, die Folgen unserer Handlungen besser zu verstehen.

14. Happy birthday sa iyo!

15. Ang mga lumang talaarawan at dokumento ay dapat na itinuring bilang mahalagang bahagi ng kasaysayan.

16. Sa bawat pagkakamali, mayroong aral na pwedeng matutunan, datapapwat ay masakit ang mawalan ng pagkakataon.

17. Habang wala pang trabaho ay matuto kang magtiis na asin ang ulam.

18. Los héroes son modelos a seguir para las generaciones futuras.

19. Saan nyo balak mag honeymoon?

20. Nakuha ko ang first place sa aking competition kaya masayang-masaya ako ngayon.

21. Ang mga nanonood ay para-parang nangapatdan ng dila upang makapagsalita ng pagtutol.

22. The Lion King tells the tale of a young lion named Simba who must reclaim his kingdom from his evil uncle.

23. The backpack was designed to be lightweight for hikers, yet durable enough to withstand rough terrain.

24. Actions speak louder than words.

25. Les enseignants peuvent enseigner différentes matières telles que les sciences, les mathématiques, la littérature, etc.

26. Il est important de prendre en compte les risques potentiels et de faire des recherches approfondies avant de décider de participer à des activités de jeu.

27. For doing their workday in and day out the machines need a constant supply of energy without which they would come to a halt

28. Natural language processing is a field of AI that focuses on enabling machines to understand and interpret human language.

29. A couple of songs from the 80s played on the radio.

30. Sa halip na malungkot, bagkus ay nagawa pa nitong magpasalamat sa lahat ng kanyang taga-suporta.

31. We admire the courage of our soldiers who serve our country.

32. Hindi ko mapigilan ang sarili ko na mahumaling sa mga Korean dramas.

33. **You've got one text message**

34. Nagsmile siya, Uuwi ka ha.. uuwi ka sa akin..

35. Limitations can be financial, such as a lack of resources to pursue education or travel.

36. Puwede paki-ulit ang sinabi mo?

37. Sudah makan? - Have you eaten yet?

38. Emphasis can be used to create a memorable and impactful message.

39. Hindi ko maipaliwanag ang aking agam-agam sa magiging resulta ng aking pagsusulit.

40. Ang may-akda ay nagsusulat ng libro upang ibahagi ang kaniyang kaalaman at karanasan.

41. I absolutely agree with your point of view.

42. Les banques jouent un rôle clé dans la gestion de l'argent.

43. Si Chavit ay may alagang tigre.

44. He is typing on his computer.

45. The backpack was so hefty, it felt like it weighed a ton.

46. Aquaman has superhuman strength and the ability to communicate with marine life.

47. ¿Quieres que le agregue un poco de picante a tu comida?

48. I have a craving for a piece of cake with a cup of coffee.

49. Has she taken the test yet?

50. Inakalang tama ang sagot niya sa pagsusulit, ngunit mali pala.

Recent Searches

eitherslavetiyabathalapasinghalmichaeltalecouldflyretirarkinuhamagpa-ospitalnagliwanaghanginkinakailanganuugud-ugodnagkasakitkampanamatabanghumahagoktrengayundinspapalayoulitnagsalitaseveralboyetneaampliagawinggawinatensyongyoutube,marurusingkasaganaansumisidlubosideyanaglinisbinasatelephoneculturabaonkulotnapaplastikannakabiligeneratedkatagalwonderlinyadosenangimpacthumbletatlosumpamasyadoinsektopiecesformlifemasasayapag-asapagkakatayonagtawananbloggers,hiraminuulcernagdadasalsalbahengkomedorpawiinpagkuwanpagamutantumalimna-fundnagsmilewishingtvsdragonpitakaprovidemoodheymemorialstardevelopedbilhinikinatatakotbaku-bakongtonmakatarungangnakadapanakapagsabipagkaimpaktokonsultasyoninirapannakatunghaypatutunguhannakapapasongmakikipaglaromagpalagoproductividadpambatangutak-biyanakatalungkohitakaharianleksiyonkasintahanpumulotcardigankaninomaglaromakaiponpagkaawaintramuroshaponvidenskabalapaappasswordpinalambotjolibeepanunuksomabibingisikattiemposkabighapakilagaymakakasuriinnatitiyakpwestopigilannaabotjeepneynatutulogiiwasantotoopagbabantatrentabopolssayawanpulitikokutsilyopampagandabumagsakbibilipangakogasmennewspaperstagaroonupuanyorkpinaglarangangrowthnapagodkutodlunesipinamilifitsundaepuwedekarapatanuntimelymatigaskriskamakinangrisesalitangtumangonagdarasalbingooutlinehopesusulithuwebesmaibalikmanghulipssspagkatsaritameronkapepulubitanodorderintaingapanomustbingiattractivehdtvseekagadbatimangingisdangfurysya