Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

3 sentences found for "either"

1. The fillings are added to the omelette while it is still cooking, either on top or folded inside.

2. The number you have dialled is either unattended or...

3. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

Random Sentences

1. However, there are also concerns about the impact of the telephone on society

2. Pedro! Ano ang hinihintay mo?

3. Nació en Caprese, Italia, en 1475.

4. Les thérapies alternatives telles que l'acupuncture et la méditation peuvent aider à réduire le stress et améliorer la santé mentale.

5. Users can save posts they like or want to revisit later by using the bookmark feature on Instagram.

6. Ako nga pala si Nicolas, kinagagalak kitang makilala.

7. Women have faced discrimination and barriers in many areas of life, including education and employment.

8. Sinigang ang kinain ko sa restawran.

9. Kapitbahay ni Armael si Juang malilimutin.

10. Trump's foreign policy approach included renegotiating international agreements, such as the North American Free Trade Agreement (NAFTA) and the Paris Agreement on climate change.

11. Nasaan ang palikuran?

12. Cuídate mucho en ese barrio, hay algunas zonas peligrosas.

13. Maliit ang telebisyon ng ate ko.

14. Hindi dapat magpabaya sa pag-aalaga ng kalusugan sa pamamagitan ng regular na ehersisyo at malusog na pagkain.

15. Hindi ko maipaliwanag kung gaano kalalim ang inis ko sa mga taong nagtatapang-tapangan lang.

16. Mabini Hall ang tawag sa gusali kung saan nagsisimula ang mga klase sa Polytechnic University of the Philippines.

17. Botong boto nga sayo ang mga magulang ko eh.

18. Niloloko mo ba ako? Ang lamig lamig pa eh!

19. Disse virksomheder er ofte i førende positioner inden for deres respektive brancher, og de er med til at sikre, at Danmark har en høj grad af økonomisk vækst

20.

21. Pull yourself together and focus on the task at hand.

22. Cooking at home with fresh ingredients is an easy way to eat more healthily.

23. A latte is a popular espresso-based drink that is made with steamed milk.

24. The surface of the hockey rink is made of ice, which can be slippery and challenging to navigate.

25. Bakit? sabay harap niya sa akin

26. In recent years, the telephone has undergone a major transformation with the rise of mobile phones

27. As a lightweight boxer, he had to maintain a strict diet to stay within his weight class.

28. Nagsalita ako upang iparating ang aking pagtutol sa kanilang plano ngunit hindi nila ito pinakinggan.

29. Allen "The Answer" Iverson was a lightning-quick guard known for his scoring ability and crossover dribble.

30. Ang lugar na iyon ay tila isinumpa.

31. Pumasok ka na lang sa kwarto. Susunod na lang ako..

32. Ang mailap na kaharian ay kailangan paghirapan upang mapasakamay.

33. Diyan ang bahay ni Mr. Marasigan.

34. Las redes sociales pueden ser un lugar para encontrar y unirse a comunidades de intereses comunes.

35. Kinagalitan si Bereti at pinauwi ngunit ayaw sumunod ng bata.

36. Anong tara na?! Hindi pa tapos ang palabas.

37. Ang malalakas na hiyaw ng galit at pagkadismaya ay binulabog ang kapayapaan ng pagtitipon.

38. Bahagya na niyang maulinigan ang ina.

39. I don't want to cut corners on this project - let's do it right the first time.

40. Malalaki ang ahas na nakakulong sa zoo.

41. The La Brea Tar Pits are a unique natural attraction, preserving fossils and prehistoric remains.

42. Sumali ako sa Filipino Students Association.

43. Ang sugal ay isang pampalipas-oras na aktibidad na may kaakibat na panganib ng pagkakabigong pinansyal.

44. Las serpientes mudan su piel periódicamente para permitir su crecimiento y eliminar parásitos.

45. Naiipit ang maraming tao sa pagsapit ng aksidente sa ilalim ng tulay.

46. Ang kaulayaw ay mahalagang bahagi ng buhay ng isang tao.

47. The coffee shop has a variety of blends and flavors available, from dark roast to vanilla latte.

48. Women have diverse interests and hobbies, from sports and fitness to travel and cooking.

49. Mathematical concepts, such as geometry and calculus, are used in many everyday activities.

50. Nagsisilbi siya bilang guro upang ituro sa kanyang mga estudyante ang tamang edukasyon.

Recent Searches

eithergappag-iinatbabemeanssorepalaginagkakasyapublicitynasiramagpagupitnapatunayannag-iisipmanahimiklandslidecrazyinabotgodginamotcommunicationasultradeinimbitaeffortsataamazonsilid-aralanrefpamagatleukemiakasingforeverdividescolorkahilingansumigawsundalocapacidadsportsbibisitagalaanbecamebowlulamsawarolledkotsengrecentnaawamahiwagakapatawarankahusayanhinanakitherramientanasiyahancityoftemaishawakkuripotnanaisinhangaringfederalbalingandiagnosticmaiingaypalapagginoongmarinighumanolihiminatakenagbababatatlongbilistsaayourself,kinabukasankasangkapanrelevantkara-karakamaligayacombinedhetokapiranggotipinanganakakinghinalungkatnaiwanggoodeveningconvertidasbalik-tanawbahay-bahayarghninanaisvedvarendenakainuniversitytubig-ulanipinabalottechnologysteamshipssapilitangrebolusyonpinamalagiphilippineinterestpagkabuhaypagbabantababaliknewspapersnapakahabanapakabutinapadungawgreatlypinyuannakagawiannagtitindapagdaminagmumukhasupportnaglokohanmaitimnagdarasalmaximizingmatulunginmapagbigaymamanhikancreatingmakikiligomakatulongmahinahongathenaconventionalkatutubomagkasakitmagkapatidlumalangoyabstaininglabinsiyamkonsiyertokaratulangnagdaramdamkapitbahaygusting-gustoipapautangipagtimplaintramurospinakamagalinginfluencesespadaprosperprovecorasusunduinpamumunoincredibleideologieshinihintayhanapbuhayhalinglinggreenhillsgraduationnapasigawginugunitah-hoynaguguluhannakilalanakakapagoddumadatingnakakarinigcancertinutopnagdiretsobinibilanghouseholdminamadaliaga-agarektangguloartificialwednesdayspendingtumatawadawitinstoplightpagmasdanbinitiwanwriting,na-curiouspinabulaanspaghettisinundangsino-sinomakulitganangganitomatikmankaybilissharmainemapapa