Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

2 sentences found for "hayaan"

1. Hayaan mo akong magbayad ng lahat.

2. Hayaan na lang daw na mapagod ang mga mababangis na hayop at ibon sa pakikipaglaban basta sa kampo ng panalo siya sasama; hagikgik nito.

Random Sentences

1. They do not eat meat.

2. Les employeurs cherchent souvent des travailleurs expérimentés.

3. Hiram na libro ang ginamit ko para sa aking research paper.

4. Gayunman, si Cupid ang nabighani sa kagandahan ni Psyche.

5. La calidad y la frescura de los productos agrícolas dependen en gran medida de la habilidad y la dedicación del agricultor.

6. Individuals with baby fever may feel a strong urge to nurture and care for a child, experiencing a deep emotional connection to the idea of becoming a parent.

7. The rise of social media has further expanded the reach of the internet, allowing people to connect with friends and family, as well as share their thoughts and experiences with a global audience

8. Sa aking paglalakad, natatanaw ko ang magandang tanawin ng bukid na pambihirang nagpapalaya sa aking isipan.

9. Sa aling bahagi ng pelikula ka natawa?

10. It can be helpful to get feedback from beta readers or a professional editor

11.

12. She speaks three languages fluently.

13. Ano ang isinusuot ng mga estudyante?

14. The early bird catches the worm.

15. Binanggit ko na sa kanila ang aking pagtutol sa kanilang desisyon ngunit hindi nila ako pinakinggan.

16. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

17. Lalo itong nalungkot nang malamang magdaraos ng isang handaan ang Adang kagubatan.

18. In 1977, at the age of 42, Presley died of a heart attack

19. Dumaan ka kay Taba mamayang pag-uwi mo, narinig niyang bilin ng ina.

20. These films helped to introduce martial arts to a global audience and made Lee a household name

21. Naiinis na talaga ako. Kelangan ko ng tulog.

22. Kumaripas si Lito nang makita niyang naglalakad na papalapit ang guro niya.

23. The internet has also led to the rise of streaming services, allowing people to access a wide variety of movies, TV shows, and music

24. The United States has a system of checks and balances, where each branch of government has the power to limit the power of the other branches

25. Better safe than sorry.

26. Pakibigay sa akin ang listahan ng mga kailangan nating bilhin sa palengke.

27. His unique blend of musical styles

28. Madalas akong matulog sa silid-aralan dahil boring ang paksa.

29. Ilang gabi pa nga lang.

30. Huwag magpabaya sa pag-aasikaso ng mga responsibilidad sa tahanan o sa trabaho.

31. Siya ang pangunahing lider ng Katipunan sa Cavite.

32. Busog pa ako, kakatapos ko lang mag merienda.

33. Børn bør have tid og plads til at lege og have det sjovt.

34. La persona ebria en la calle está llamando la atención de los transeúntes.

35. Napilitan silang magtipid ng tubig dahil sa patuloy na tagtuyot.

36. Ailments can be diagnosed through medical tests and evaluations, such as blood tests or imaging scans.

37. Ang tamang dami ng pagtulog ay nakakatulong sa pagpapalakas ng immune system.

38. Mataba ang lupang taniman dito.

39. Grabe ang lamig pala sa Japan.

40. Les personnes âgées peuvent bénéficier de services de soins à domicile pour maintenir leur indépendance.

41. Paglingon niya, nakakita siya sa kanyang tabihan ng isang munting palaka na parang nakatinging sa kanya

42. Marahil ay nagpaplano ka na ng susunod mong bakasyon kaya't dapat kang mag-ipon.

43. Ang bato ay hindi mahuhulog kung walang sisidlan.

44. Fødslen markerer en begyndelse på et nyt kapitel i livet som forældre og en påmindelse om, at livet er en konstant cyklus af transformation og fornyelse.

45. The project gained momentum after the team received funding.

46. I've been using this new software, and so far so good.

47. Smoking is more common among certain populations, such as those with lower socioeconomic status and those with mental health conditions.

48. I am absolutely determined to achieve my goals.

49. My coworkers threw me a surprise party and sang "happy birthday" to me.

50. Inflation kann dazu führen, dass Unternehmen Schwierigkeiten haben, Kredite zu erhalten.

Similar Words

hayaang

Recent Searches

nakatindighayaanbihirangpagbibiropagguhitregulering,companiesmilyongtotooeksempelbangkangtumatakboe-booksmatandangjulietcrecerconclusion,sandwichmaynilauwaktanyaginiresetabalikatpantalongsasagutinbuwandoktorsalalingidjoshdeterioratefonosgenesuccess00ampagodganyanpalibhasaawitinsisentaligaliginastakumustaberetihanapinduwendetransportmalilimutanarkilasuwailpamanmarmaingbalingannakatinginsisidlannapapikitpondomaatimdiseaseasinchadbinabaliknagbungaboksingibalikbook:aalisjudicialsukatnatanggapcryptocurrencyratemapadalisingercontinuesvedcharmingsciencekingpaslitiosroboticgreenworkshopmapclassesdatalargemonitoractorduloinformedformatniceimproveddeclarecomouponrecentpeterresourcescorrectingdebatesbathalatoodoonrestmulighederkotseh-hoybumababamagsalitatinikmaninangkinainfallpangarapdasalkagayaanghelallowsnahigitanalignsakmangtunaytinaytigastheirteachtalataksiputolsuelospentsparesiyamdisfrutarmaskinerlalakadsalesroughredesdumaloproudparinpalayolivanyangniyonmanamis-namisneverneedsnayonnaunanatinnanagmoneyalikabukinerlindameansmayormaongmaarilawayjejuberegningerkirotkasoyyatatshirtkalyejerryitaasipinapinagpapaalalahananideasasukalidea:gagambaiconsgustogiraynakakapagpatibaygawangamesmagsisimulatinatanongfotosfloordurasmakapangyarihangipihitfalladinigdalawdaangpetsang18thclockclean