Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

12 sentences found for "interest"

1. As a lender, you earn interest on the loans you make

2. Foreclosed properties may be sold with special financing options, such as low down payments or low interest rates.

3. He used his good credit score as leverage to negotiate a lower interest rate on his mortgage.

4. Hendes interesse for kunst er fascinerende at se på. (Her interest in art is fascinating to watch.)

5. It is often characterized by an increased interest in baby-related topics, including baby names, nursery decor, and parenting advice.

6. It's crucial to pay off your credit card balance in full each month to avoid interest charges.

7. Maaaring magkaroon ng interest at late fees kapag hindi nabayaran ang utang sa tamang panahon.

8. Musk has expressed interest in developing a brain-machine interface to help treat neurological conditions.

9. She has excellent credit and is eligible for a low-interest loan.

10. She's trying to consolidate her credit card debt into a single loan with lower interest rates.

11. The credit union provides better interest rates compared to traditional banks.

12. They offer interest-free credit for the first six months.

Random Sentences

1. Some critics argue that television has a negative impact on children, as it can lead to decreased attention spans and a lack of physical activity

2. La seguridad y el bienestar de los agricultores y sus familias son importantes para garantizar un futuro sostenible para la agricultura.

3. Nagkakasayahan sila sa isang panig ng bilangguan

4. Ang aking Maestra ay napakabait.

5. Saan nangyari ang insidente?

6. Memberikan dan melakukan tindakan baik kepada orang lain dapat meningkatkan kebahagiaan kita.

7. Tesla's Autopilot feature offers advanced driver-assistance capabilities, including automated steering, accelerating, and braking.

8. Walang ano-ano ay lumipad at nakita ni Perla ito na pumunta sa halamanan at nagpalipat lipat sa mga bulaklak.

9. En el legado de Da Vinci se encuentra una gran cantidad de cuadernos y dibujos de sus estudios.

10. Nagka-bungang-araw si Baby dahil sa sobrang init.

11. Ano ang sukat ng paa ni Elena?

12. Sinubukan niyang salatin ang pader sa dilim upang makahanap ng pinto.

13. A couple of goals scored by the team secured their victory.

14. Sa mga gubat ng Mindanao, may mga punong-kahoy na may napakalaking kahoy at tinatawag itong "Lauan".

15. They play video games on weekends.

16. Sobra. nakangiting sabi niya.

17. Additionally, the advent of streaming services like Netflix and Hulu has changed the way that people consume television, and this has led to the creation of a new form of television programming, known as binge-watching

18. Seguir nuestra conciencia puede requerir coraje y valentía.

19. The Constitution divides the national government into three branches: the legislative, executive, and judicial branches

20. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

21. May dalawang libro ang estudyante.

22. Instagram is a popular social media platform that allows users to share photos and videos.

23. Wow, talaga? Para kayong vampires, sa gabi nabubuhay.

24. Sumimangot ako at humarap ulit sa labas.

25. Mange transkønnede personer oplever at blive udsat for chikane, mobning og vold på grund af deres kønsidentitet.

26. Sweetness is a sensation associated with the taste of sugar and other natural and artificial sweeteners.

27. Nasa Pilipinas na si Raymond ngayon.

28. Napansin ko ang bagong sapatos ni Maria.

29. Tatanghaliin na naman bago siya makasahod.

30. Hun har ingen idé om, hvor forelsket jeg er i hende. (She has no idea how in love I am with her.)

31. Sa condo ko. nakangiti niya pang sagot.

32. Nakatira si Nerissa sa Long Island.

33. Emphasis is an important tool in public speaking and effective communication.

34. Una buena conciencia nos da una sensación de paz y satisfacción.

35. Different types of work require different skills, education, and training.

36. My son drew a picture of a pretty lady with a big smile.

37. Noong una ayaw nilang paniwalaan ang bata ngunit di naglaon ay tinikman din nila ito at napag-alaman ngang matamis ang bunga.

38. Hindi dapat nating pabayaan ang ating mga responsibilidad sa buhay, samakatuwid.

39. Las escuelas también pueden ser religiosas o seculares.

40. Einstein's intellectual curiosity, creativity, and persistence in the face of challenges serve as a model for aspiring scientists and scholars.

41. He has been hiking in the mountains for two days.

42. Pinagmamalaki ng mag-asawa ang kanilang anak dahil hindi lang maganda si Lorena kundi ay matalino at may mabuting kalooban din.

43. Ang pangungutya ay hindi magbubunga ng maganda.

44. La literatura japonesa tiene una sutileza sublime que trasciende las barreras culturales.

45. Pets, including dogs, can help children develop empathy and responsibility.

46. Ano ang nasa bulsa ng bag niya?

47. Puwede ba akong sumakay ng dyipni?

48. I know we're behind schedule, but let's not cut corners on safety.

49. Ipinabalot ko ang pakete sa kapatid ko.

50. Inalis ko yung pagkakayakap niya sa akin. At umupo sa sofa.

Similar Words

interests,interests

Recent Searches

yesinterestdialledhumanoi-recharge1929robertcakeannahapdipreviouslysharenamebosescommunicationnagre-reviewdapit-haponnagliniswritetutorialsfrogseparationcharitablebroadcastingelectedbasanananaghilis-sorrytopic,marketingmagpuntapancitcarbonibonbinitiwanrepublicantuwingsangkalanrockpag-akyatmachinescryptocurrency:paghaharutanpinakamatapatmaibibigaybarcelonabehaviordisposalstaplemasayang-masayagawingmagpa-checkupnasabiafteripapainitamoydibapaskodahillapissupilincreditkubopaldatiyalunascarolorganizeso-calledkikitasinusuklalyankungvehiclespalabuy-laboynakalilipasuulaminmasyadongtanggalinfitnessproductividadallowedfilipinapalancasharmainenapagtantohitanakuhapagtataashampaslupainsektongngumingisisalbahengabundantekaninumansukatumakbaykuryentenagsmilemagtiistumalimtumahanreportdiwatalumakidarknag-googlenglalaba1982pakiramdamsystematiskpaulit-ulitcruznaliligomahuhulipasaheromangyaritinahaknapahintokumampihinahanapbumilitraditionallalomaibaknightdiyossahodpagkaawaisinaboypahabolcinekadalasprincipalessay,higantetinikmankumantapaalamlolataga-hiroshimapropesornakarinigmakilalalabisinlovedesign,pagsusulitinitpampagandabanlagteachingsebidensyasongslumbaynangingitngitnakaintusongrolledmaisippersonsantosbagonginintaykatulongpulongdalawinmariet-shirtprovekusinamoviesisidlanincreasinglynag-iyakanpawiindontnangahasbinabalikrenacentistamagkasakitbahagyangnageespadahanhinding-hindilaki-lakimagpa-ospitallumalangoynakakapamasyalkategori,pagkakapagsalitaryanpasyamagbabagsikdisciplinpagsumamokapangyarihangsuzetteikinagagalakpaamassachusettspagbabagong-anyo