Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

2 sentences found for "cable"

1. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

2. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

Random Sentences

1. Lumuhod siya sa harap ng altar at tulala sa loob ng ilang minuto.

2. From there it spread to different other countries of the world

3. "Dogs are not our whole life, but they make our lives whole."

4. The project gained momentum after the team received funding.

5. Arbejdsgivere leder ofte efter erfarne medarbejdere.

6. Traveling to a conflict zone is considered very risky.

7. I'm going to surprise her with a homemade cake for our anniversary.

8. Saan nakatira si Ginoong Oue?

9. Leukemia can be cured in some cases, but long-term monitoring is necessary to prevent relapse.

10. The lightweight fabric of the dress made it perfect for summer weather.

11. Umihip ang malamig na hangin, waring may paparating na masamang balita.

12.

13. If you're trying to get me to change my mind, you're barking up the wrong tree.

14. Sa sobrang hiya, siya ay lumakad palayo mula sa harap ng maraming tao.

15. Franklin Pierce, the fourteenth president of the United States, served from 1853 to 1857 and was known for his support of the Kansas-Nebraska Act, which contributed to the outbreak of the Civil War.

16. Sumakay kami ng kotse at nagpunta ng mall.

17. I am absolutely certain that I locked the door before leaving.

18. Kapatid mo ba si Kano? isasabad ng isa sa mga nasa gripo.

19. Sa aming tahanan sa tabing-karagatan, mahinahon ang aming buhay.

20. Ipabibilanggo kita kapag di mo inilabas ang dinukot mo sa akin.

21. Higupin natin ang gatas habang mainit pa.

22. Biglang kumaripas ng takbo ang magnanakaw nang makita ang mga pulis.

23. Ang tubig-ulan ay maaaring magdulot ng malinis na hangin sa pamamagitan ng pag-alis ng polusyon sa hangin.

24. Les impôts sont une source importante de revenus pour l'État.

25. Nakukulili na ang kanyang tainga.

26. Puedes saber que el maíz está maduro cuando las hojas inferiores comienzan a secarse y las espigas están duras al tacto

27. Inalagaan ito ng pamilya.

28. Bilang paglilinaw, wala akong sinabing tataasan ang singil, kundi magkakaroon lang ng kaunting pagbabago sa presyo.

29. Paano po pumunta sa Greenhills branch?

30. The members of the knitting club are all so kind and supportive of each other. Birds of the same feather flock together.

31. Lumapit siya sa akin at sumandal sa may sink.

32. Sweet foods are often associated with desserts, such as cakes and pastries.

33. Nogle helte er berømte idrætsstjerner.

34. Cryptocurrency is often subject to hacking and cyber attacks.

35. Tumingin ito sa mga website ng mga bagay na pwedeng bilihin online.

36. Huwag ka nanag magbibilad.

37. Gracias por ser una inspiración para mí.

38. Ang pagpapalit-palit ng oras ng pagtulog ay maaaring makapanira sa sleep cycle ng isang tao.

39. Naghihinagpis si Maria nang malaman niyang hindi na niya makakasama ang kanyang pinakamamahal na aso.

40. Ailments can be acute or chronic, meaning they may last for a short period of time or a long period of time.

41. Pinagpalaluan ang Kanyang karunungan.

42. Umalis na si Nicolas patungo sa paaralan.

43. May bagong aklat na inilathala ukol kay Manuel Quezon at tungkol ito sa pag-unlad ng teknolohiya.

44. Ang tagumpay ng ating bayan sa larangan ng sports ay ikinagagalak ng buong bansa.

45. Anong wala! pasinghal na sabi ni Aling Marta

46. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

47. Overall, television has had a significant impact on society

48. Kenji nandito na siya! sabi sa akin ni Grace.

49. El trigo es uno de los cultivos más importantes a nivel mundial para la producción de harina.

50. Lazada's mobile app is popular among customers, with over 70 million downloads.

Recent Searches

generatedmulingcableroughincreasesfourjohnpowersbeyonddraft,inteligentesinilingipaghugassumigawmaglalabingpresidentmagkakapatidhongulamdissebiocombustiblesmaintindihannawawalanagreklamoliv,gayunmankumbinsihinpagngitikinapanayammakakatakasnakakapagpatibaysalu-salonalakiawtoritadongganitotahimiklondonambisyosangleksiyonnapagtantonakatalungkonagbantayandresbakantepagbabantatelebisyonkisapmatamakapagempakebowlunidoskumampidiinyayapumayagsurveysanitbefolkningenmakakalumusobtinuturonanamanhabitssarisaringpakiramdampangungusapkasyawouldmagtanimpanunuksolandasmaaksidentetirangpaakyattakotexigentevaledictoriananakgalitkubogusting-gustomatulungincaraballosigurocurtainssidogustongninyonglunesdesarrollarpinalayasnaalissinalayuankakayanangsumasaliwngisiumiiyakproudkatapatnagisingwifikirottsupermissionvivacarlonakasakaypongnuhlipadkindsimagesedsanahihilomaibaliknaglabananbawianhigaprutasanitogoodeveningmembersseniorblusainterestshmmmiconicbiyaslapisdalawapulubispareitinagoburmanumerosasbiglacelularesnakapuntabatisubjectpitakatingjerrylord1940accederhydelshockintroducedragoninalisleebipolarmarsoipinikitcalldingginstudentstopic,badaddellentuwidfistsdidingmalusognabigkasmarkedsekonomiburoltalewhyrecentconsidercreatingfigureipagtimpladinalaboxnerissagraduallyguromungkahikapilingprogramabehaviorrequireilingbetweenandroidexamplelaterpinangalanangmakabilipangkaraniwangmalawakkagayaoncekagabikumaingayunpaman