Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

2 sentences found for "cable"

1. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

2. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

Random Sentences

1. In conclusion, Elvis Presley was a legendary musician, singer and actor who rose to fame in the 1950s and continues to influence the music industry and American culture till this day

2. Dapat bigyan ng karampatang atensyon ang mga isyu ng sektor ng anak-pawis.

3. Naputol yung sentence ko kasi bigla niya akong kiniss.

4. Allen "The Answer" Iverson was a lightning-quick guard known for his scoring ability and crossover dribble.

5. Good things come to those who wait.

6.

7. If you think he'll lend you money, you're barking up the wrong tree.

8. Chester A. Arthur, the twenty-first president of the United States, served from 1881 to 1885 and signed the Pendleton Civil Service Reform Act.

9. Gayunman, si Cupid ang nabighani sa kagandahan ni Psyche.

10. Nahihilo ako dahil masyadong mainit ngayon.

11. Kumakain ng tanghalian sa restawran

12. Sa dapit-hapon, madalas kaming magtungo sa park para maglaro ng frisbee.

13. Its cultivation on a wide scale with the help of negro-slaves made it one of the major export items in the American economy

14. Danmark eksporterer mange forskellige varer til lande over hele verden.

15. Talagang dito ho sa palengke'y maraming naglipanang batang gaya niyan

16. Di ka galit? malambing na sabi ko.

17. Ang pasya nang pagkapanalo ay sa tela ng matanda.

18. Les personnes âgées peuvent avoir besoin d'une aide financière pour subvenir à leurs besoins.

19. Tesla's vehicles are equipped with over-the-air software updates, allowing for continuous improvements and new features to be added remotely.

20. La práctica hace al maestro.

21. Ngumiti lang ako sa kanya at nagsimula muling halikan siya.

22. Je suis en train de manger une pomme.

23. They have been studying math for months.

24. Sino ang mga pumunta sa party mo?

25. Ang taong hindi marunong lumingon sa pinanggalingan ay hindi makakarating sa paroroonan.

26. We have been married for ten years.

27. Inalalayan ko siya hanggang makarating sa abangan ng taxi.

28. There's no place like home.

29. Pwede ba Maico, wala kang pakealam! singhal ko sa kanya.

30. Fødslen markerer en begyndelse på et nyt kapitel i livet som forældre og en påmindelse om, at livet er en konstant cyklus af transformation og fornyelse.

31. L'enseignement est un métier noble qui consiste à transmettre des connaissances aux élèves.

32. El teléfono también ha tenido un gran impacto en la forma en que las empresas se comunican con sus clientes

33. Ang mga nangunguna sa industriya ay kadalasang itinuturing bilang mga eksperto at mga awtoridad sa kanilang larangan.

34. Les employeurs peuvent utiliser des méthodes de travail flexibles pour aider les travailleurs à équilibrer leur vie professionnelle et personnelle.

35. The scientific community is working to develop sustainable energy sources to combat climate change.

36. Dumating ang hindi inaasahan ni Ranay.

37. Napuno ako ng poot nang malaman ko ang mga kasinungalingan na ibinato sa akin.

38. Women's relationships with their bodies have been shaped by societal expectations and cultural norms.

39. Si Pedro ay namamanhikan na sa pamilya ni Maria upang hingin ang kanilang pahintulot na magpakasal.

40. Eine starke Gewissensentscheidung kann uns helfen, uns selbst und andere besser zu respektieren.

41. Ang hirap naman ng exam nakaka bobo.

42. The relationship between work and mental health is complex and can vary from person to person.

43. Bantulot niyang binawi ang balde, nakatingin pa rin kay Ogor.

44. The introduction of the dial telephone in the 1920s further improved the telephone system, as it allowed for faster and more efficient call connections

45. El cuaderno de Leonardo da Vinci contiene muchos dibujos y anotaciones sobre sus inventos.

46. Ganid na sa pera ang mga taong nakaupo sa pwesto.

47. The love that a mother has for her child is immeasurable.

48. Mengatasi tantangan hidup membutuhkan ketekunan, ketabahan, dan keyakinan pada kemampuan kita sendiri.

49. Binati niya ito ng "Magandang umaga sa iyo".

50. Ano ang ginagawa mo nang lumindol?

Recent Searches

offentligdollargraduallycreatingparatingcablebulongbalik-tanawnakahainweddingsalakaguluhantwinklenalalabiisinilangsumungawcommissionrememberpinag-usapanbeforenasrolebehaviorkahalumigmiganbinabaratmapayapaayusinentrymerchandisenahintakutanbasketballpaanohumihingaltitapakibigyanmagsasakanakakitalargerotrasschoolstryghedvampirespinalutoallowingbecomingamparokablanoverallcardpolopopcornnagpapasasaknowledgedependingsameputingdoesstyrernararamdamaninfinityviewflasheveryevilreadinternaldraft,magdaankaybilismatalimkatulongpakainintayoumibigligaligvegassigurogawanapakabanlaghelenastartedshoesnangangahoypaglalayagtinaasanmakitanagsisigawipapamanablusatrainsulammagulayawtinutopnapipilitanbabasahinnaabutannaibibigayrevolutioneretnawalangimpornaguguluhancultivarhubad-baropagsuboksiksikanpartsibinilinaglokonalalabingkontratapagkaangatkakatapospanalanginmakatulogmaisusuottubig-ulananumangumagangkapataganumikottutusinnapiliiikutandiferentesnakauslingenviaredukasyonevolucionadohouseholdtotoobilismensnagniningningnagwikangpagmasdanpumikitconvey,pinaulanannabigayiniresetagarbansosmagsabiinhalekindergartenkassingulangtononanaytsssmaongestilossantosbandamaistorbopnilittagakdiallednayonnochemanilanasaipagtatapatnapakabutihugisilocoshumbleibinentaangkanboholosakasaradiyosginaganoonpatunayanasiaticautomationiniinomtransmitslendinglaryngitisiatfcalciumcellphonepresyokongpakilutobotantebeginningsoperahanmininimizelaylaytripmabutingprosperpulaitinalibinabaanpasangjaneduri