Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

2 sentences found for "cable"

1. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

2. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

Random Sentences

1. Muchas escuelas ofrecen clases de música y hay numerosas instituciones educativas especializadas en música, como conservatorios y escuelas de música

2. The United States is a global leader in scientific research and development, including in fields such as medicine and space exploration.

3. Kuwartong pandalawahan, hindi ho ba?

4. Nanggaling ako sa isang malakas na liwanag papunta sa pagdidilim ng gabi, kaya't nahirapan akong mag-adjust sa aking paningin.

5. In 2017, ariana grande organized the One Love Manchester benefit concert following the tragic Manchester Arena bombing at her concert.

6. Nay, ikaw na lang magsaing.

7. Natapos ko ang aking thesis sa dakong huli bago ko ito isinumite.

8. Leukemia research continues to improve our understanding of the disease and develop more effective treatments.

9. If you're expecting a quick solution to a complex problem, you're barking up the wrong tree.

10. Work can also have a social aspect, providing opportunities to meet new people and make connections.

11. Kapag walang makain ay naghuhukay ng mga gabi, tugi o anumang halamang ugat sina Karing para maipantawid-gutom.

12. La ingesta adecuada de fibra puede ayudar a regular el sistema digestivo y mantener la salud intestinal.

13. Tila may bumisita sa bahay kagabi dahil may bakas ng paa sa labas.

14. He makes his own coffee in the morning.

15. The elephant in the room is that the project is behind schedule, and we need to find a way to catch up.

16. The students are not studying for their exams now.

17. Athena.. gising na. Uuwi na tayo maya maya.

18. Napakalaking ahas ang nakita ni Anjo.

19. Musk has been married three times and has six children.

20. Ani Karing ay naiinggit ito kay Bereti dahil nakukuha ang lahat ng gusto.

21. A los 13 años, Miguel Ángel comenzó su aprendizaje en el taller de Domenico Ghirlandaio.

22. Nationalism can have a positive impact on social and economic development.

23. Antiviral medications can be used to treat some viral infections, but there is no cure for many viral diseases.

24. ¿Cómo te va?

25. The king's family and heirs are often closely watched by the public and the media.

26. Electric cars have a lower center of gravity, which can improve handling and stability.

27. Television has also had an impact on education

28. Pinagsisihan niya ang mga salitang hinugot niya mula sa kanyang galit.

29. We didn't start saving for retirement until our 40s, but better late than never.

30. Hindi mo inaasahan na ang simple at normal na araw ay maaaring magdulot ng agaw-buhay na pangyayari.

31. Wala nang gatas si Boy.

32. They analyzed web traffic patterns to improve the site's user experience.

33. Ano ang kulay ng paalis nang bus?

34. Financial literacy, or the understanding of basic financial concepts and practices, is important for making informed decisions related to money.

35. Nagbigay ang albularyo ng anting-anting upang protektahan ang bata sa masasamang espiritu.

36. Alam kong heartbeat yun, tingin mo sakin tangeks?

37. Algunos artistas famosos incluyen a Leonardo da Vinci, Pablo Picasso y Frida Kahlo.

38. No puedo controlar las acciones de los demás, solo puedo aceptarlas con "que sera, sera."

39. Ang sugal ay isang mapanlinlang na industriya na nakatuon sa pagkuha ng pera mula sa mga manlalaro.

40. Sa kabila ng kanyang tagumpay, may bahid ng lungkot sa kanyang mga mata.

41. Napakalungkot ng balitang iyan.

42. Ayoko pong nakakulong sa madilim na lugar na kinalalagyan ko.

43. Leukemia can be acute or chronic, depending on how quickly the disease progresses.

44. Nang magretiro siya sa trabaho, nag-iwan siya ng magandang reputasyon bilang isang tapat at mahusay na empleyado.

45. They are a member of the National Basketball Association (NBA) and play in the Western Conference's Pacific Division.

46. La música es un lenguaje universal que puede ser entendido por personas de diferentes culturas y lenguas.

47. Durante el invierno, es importante tener un buen sistema de calefacción en el hogar para mantenerse caliente.

48. Ano ang nangyari sa Compostela Valley?

49. Hospitalization can have a significant impact on a patient's overall health and well-being, and may require ongoing medical care and support.

50. Eine klare Gewissensentscheidung kann uns ein gutes Gefühl geben und unser Selbstbewusstsein stärken.

Recent Searches

cableattentionfamekapilingplanmagdidiskodealtagumpayespigasewandailykatawangpagkagisinghabaibangtinderamalilimutantradisyonkaagadmagandabulaklakumuwiyunmanatilimgahinamakpamamagakatapatmonsignorkare-karewhatsapptinurocountlesseffort,samakatuwidpigingmaylunasemocionanteeducationalcocktailaralaksiyonmimosamaninipisoperahanpinabulaanmaligoprocesopag-alagapumasokasahannagdaosnatawakananestudyanteinangdresskatieitomagsasakasenadorunibersidadhinabolmagbakasyonbumibililumitawfaultnationaltubig-ulannakamalungkotpalahandakaninaevolvedsumasakaypusosusunodsalamattamadmahabaiiyakanothertungkolexpandedkangkausapinasulcomplexkaraoketaospulisgloriamukhatahimikhalu-halonasisiyahannapabalikwasspiritualginaganapgustonagnatatawatinitignannapatigninminutopag-indakguidesasabihinsiyasong-writingsentencemadalasganangmang-aawitvaccinessmokingalingnasabiskynakakaalamaga-agablessshowermakatulogbabesgalakimportantenaiskagabilagaslaslikurantradekinissmatagumpaybinabaratstorylabing-siyammalakaskamiboksinginakyatstudentsnasusunogbagkus,cramepagtutolnanagsusunduinnakuhabigaswidepunsotaun-taondonehalamananiyamalalapadnagtatanimmayroongbeginningshukaykamingekonomiyabatangsiopaooccidentaltungkodnapasubsobulamaustraliabaoworryfamilykinukuyomamazonkasalgreatlynaglalaroitinuturopabalikpalengketindigkamapisiuusapanmagdalamaya-mayakikitagumagamitwhatevernagpuyosveryisanatagobiglaannanaogdesarrollarku-kwenta