Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

2 sentences found for "cable"

1. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

2. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

Random Sentences

1. El nacimiento de un bebé puede tener un gran impacto en la vida de los padres y la familia, y puede requerir ajustes en la rutina diaria y las responsabilidades.

2. nakita niya ang naghuhumindig na anyo ni Ogor.

3. Takot at kinakaliglig sa lamig ang Buto.

4. Una dieta equilibrada y saludable puede ayudar a prevenir enfermedades crónicas.

5. Gusto ko dumating doon ng umaga.

6. I am writing a letter to my friend.

7. Ha? Ano yung last na sinabi mo? May binulong ka eh.

8. It's important to be careful when ending relationships - you don't want to burn bridges with people you may encounter in the future.

9. Si Leah ay kapatid ni Lito.

10. Sumalakay nga ang mga tulisan.

11. Pinagpalaluan si Maria ng kanyang mga kapatid dahil sa kanyang sipag at tiyaga.

12. James Madison, the fourth president of the United States, served from 1809 to 1817 and was known as the "Father of the Constitution."

13. Magkita tayo bukas, ha? Please..

14. Hockey has a rich history and cultural significance, with many traditions and customs associated with the sport.

15. Nogle helte går frivilligt ind i farlige situationer for at redde andre.

16. Las noticias en línea pueden ser actualizadas en tiempo real.

17. They engage in debates and discussions to advocate for their constituents' interests and advance their agendas.

18. The culprit who stole the purse was caught on camera and identified by the victim.

19. The Amazon Rainforest is a natural wonder, home to an incredible variety of plant and animal species.

20. Le musée d'Orsay est un incontournable pour les amateurs d'art.

21. Mathematics has many practical applications, such as in finance, engineering, and computer science.

22. The Lakers have a rich history and are one of the most successful franchises in NBA history.

23. Mas maganda pa ring magpatawad kaysa magtanim ng inis sa puso.

24. Durante las vacaciones, nos reunimos alrededor de la mesa para compartir historias y risas con la familia.

25. May problema ba? nagtatakang tanong ni Maico.

26. Di ko sya maistorbo dahil sya ay nag-aaral pa.

27. Dogs are social animals and require attention and interaction from their owners.

28. Many churches hold special services and processions during Holy Week, such as the Stations of the Cross and the Tenebrae service.

29. Nagtagisan ng galing ang mga maghahabi.

30. Wala ho akong dinukot na maski ano sa kanya.

31. Mayroon nang natanggap na impormasyon ang pulisya tungkol sa pagkakakilanlan ng salarin.

32. Naging kaibigan ko ang aking guro sa Sining dahil sa aming parehong hilig sa art.

33. Berapa harganya? - How much does it cost?

34. Natutunan ko ang mga awiting Bukas Palad mula sa aking mga magulang na parehong Katoliko.

35. Ang hinagpis ng isang ina ay dama sa kanyang bawat hikbi habang inaalala ang kanyang nawalang anak.

36. Sige, oo na lang tayo kahit sa totoo lang, ang baduy.

37. My sister gave me a thoughtful birthday card.

38. Ang mga mamamayan ay nagpahayag ng kanilang mga mungkahi upang maresolba ang mga suliranin sa kanilang barangay.

39. Ang mga nagtatagumpay sa negosyo ay madalas na itinuring bilang mga modelo ng tagumpay at inspirasyon para sa iba.

40. Good morning, Beauty! aniya sabay halik sa mga labi ko.

41. Det er en metodisk tilgang til at forstå verden omkring os og finde årsager til de fænomener, vi observerer

42. This has led to increased trade and commerce, as well as greater mobility for individuals

43. If you think I'm the one who stole your phone, you're barking up the wrong tree.

44. Amazon has faced criticism over its treatment of workers and its impact on small businesses.

45. Omelettes can be cooked to different levels of doneness, from slightly runny to fully set.

46. Sa ilalim ng malawak na upuan, nakita ko ang isang mayabong na lumot.

47. Nakaramdam na lang ako biglang may humampas ng ulo ko.

48. Twitter has millions of active users worldwide, making it a powerful tool for real-time news, information, and social networking.

49. Lazada has partnered with government agencies and NGOs to provide aid and support during natural disasters and emergencies.

50. Wag ka nang malumbay dahil nandito naman ako.

Recent Searches

maghaponrelobalahibocablenami-missmaalwangginanakakapasokmalayangrefnapagsilbihanetonagmamadalinakukuhareleasedagilitypaoskasuutanbarrocomasasabimatandangpelikulamatangumpaykadalaseyepagpapatubogregorianomaipantawid-gutomattractivepamilihanhimigmagtanghalianmonumentonasaangpaki-ulitkailanmanmagagandangandybotodiagnosticmakapagsabiblessbataymaghahatidmodernnglalabaestablishedkumapitnapatigileleksyonkargahancarlokriskadahonmagpapabunotbigyanballoverincreaseimpactedmapaikotnamangmagpapagupitthoughtsmatiyakgumagawastrategynapapatinginevolvedlupainnaggalamanakbomagsunogpigingcesouemakaratingsummerskills,tumingalaibinaonitinalisagasaandeliciosaborndisplacementcnicodiscoveredcomolawszoocongratsmagsasakafriendtungawmaaringeroplanopaghihingalomatalinonapadpadsalu-salodibapalangpagpapakainpaglayastiyakpakealampumapaligidkuryentesmilemaestrangisimongdibisyonalapaapnagpaalamsiopaobinili1787kwartoibonmaglababowlpaanongtsakakumantamainitmagpagalingexistkaugnayanmulidiseasespagka-maktoltuklassalubongnagpalutodetteentermagsusuotstoplightpaghuhugasnagplaycharitabletanyagbaldeabonowatergaanopinagsikapanpinangalananmarinigumiisodmarketplaceskarapatanmagtataasaustraliadekorasyonlaamangpresskuwentoindiamenscancerindustrycarsactualidadcompanynakatirangpriestwalkie-talkiemasungitkalayuantagumpayinstrumentalroombiyernesdisyemprekaaya-ayangkontratanagbigaymajorbecamepinahalatadependkalaunanlangkaykinumutanganitodumagundongkagandahantulisantodaskatagaeditordilawmabutikambingbiggestpalasyonakakadalaw