Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "kinanta"

1. Oo, kinanta 'to sakin ng isang babaeng kinaiinisan ko...

Random Sentences

1. I have been studying English for two hours.

2. Bakit niya gustong magpahaba ng buhok?

3. Kings may have ceremonial duties, such as opening parliament or receiving foreign dignitaries.

4. Siya ho at wala nang iba.

5. We have been cooking dinner together for an hour.

6. La comida mexicana suele ser muy picante.

7. Ano ang binibili ni Consuelo?

8. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

9. Inalok niya akong sumama sa kanyang outing, datapwat may iba akong plano para sa araw na iyon.

10. Lazada has a social commerce feature called Lazada TV, which allows customers to buy products directly from influencers and celebrities.

11. La pintura al óleo es una técnica clásica que utiliza pigmentos mezclados con aceite.

12. Orang Indonesia memiliki beragam tradisi dan budaya dalam melakukan doa.

13. I know I should have gone to the dentist sooner, but better late than never.

14. Ang taong na-suway sa kautusan ay maaaring pagmultahin o parusahan.

15. May dalawang puno sa harap ng bahay namin.

16. Nakahiga ako sa gabi nang biglang magkaroon ng malakas na kidlat at nagitla ako sa takot.

17. Many people exchange gifts and cards with friends and family during Christmas as a way of showing love and appreciation.

18. Elle peut être interne, c'est-à-dire provenant de soi-même, ou externe, provenant de l'environnement ou de la pression sociale.

19. En invierno, la nieve puede causar problemas en el transporte, como retrasos en vuelos y cierres de carreteras.

20. His charitable nature inspired others to volunteer at the local shelter.

21. Ang pag-asa ay nagbibigay ng lakas sa mga tao upang labanan ang mga hamon sa buhay.

22. Bukas na lang ako pupunta sa bangko.

23. Haha! I'd want to see you fall inlove tonight.

24. All these years, I have been blessed with the love and support of my family and friends.

25. Algunas serpientes son conocidas por su capacidad para camuflarse en su entorno, lo que les permite acechar a sus presas de manera efectiva.

26. Dedication is the commitment and perseverance towards achieving a goal or purpose.

27. Ang pagiging malilimutin ni Ana ay laging nagdadala ng problema sa kanilang grupo.

28. The Great Wall of China is an impressive wonder of engineering and history.

29. The argument was really just a storm in a teacup - it wasn't worth getting upset over.

30. Mababa ang kalidad ng produkto kaya hindi ito nagtagal sa merkado.

31. Nagluto ako ng adobo para kina Rita.

32. Inflation kann die Arbeitsbelastung der Zentralbank erhöhen.

33. We were trying to keep the details of our business plan under wraps, but one of our investors let the cat out of the bag to our competitors.

34. Nagsagawa ng ritwal si Matesa upang sumpain ang anak ng mag-asawa.

35. Cancer awareness campaigns and advocacy efforts aim to raise awareness, promote early detection, and support cancer patients and their families.

36. Baka nga si Amba pa gumawa ng tela aniya.

37. Masarap ang bawal.

38. Si Pedro ang tatay ko at siya ang nanay ko.

39. Many dogs enjoy going on walks and exploring new environments.

40. El invierno es una época del año en la que las personas pasan más tiempo en interiores debido al clima frío.

41. Las redes sociales pueden ser adictivas y consumir mucho tiempo.

42. The acquired assets included a portfolio of real estate properties.

43. Being charitable doesn’t always involve money; sometimes, it’s just about showing kindness.

44. I'm on a diet, but I couldn't resist having a small slice of cake.

45. Hanggang mahulog ang tala.

46. Det er også vigtigt at spise en sund og afbalanceret kost for at støtte ens træningsmål og sundhed generelt.

47. Umihip ang malamig na hangin, waring may paparating na masamang balita.

48. "Ang buhay ay parang gulong, minsan nasa taas, minsan nasa baba," ani ng matandang nagkukuwento.

49. Palibhasa ay mahilig siyang magbasa, kaya marami siyang nalalaman sa iba't-ibang paksa.

50. The United States has a system of checks and balances, where each branch of government has the power to limit the power of the other branches

Recent Searches

kinantabalitamamayapogijeromenagmadalingkasigrabeamountfiancenagawantataylabinsiyamtoretetugonalagamagawanaroonpalibhasabeforesumakaykaninaheartbeatpakealamkarangalanpaticongratstwitchmaliitbinabaratnariningprovidemapagbigaytayotiyakasawamadamotpakanta-kantangtagsibolsedentarykamakailanwatawatpakainininsektongkapangyarihangnaiiritangisinuoterhvervslivetdogsnagliliwanagdyosamalezaosakapinagmamalakishopeepinagtagpoasiasoccerfaktorer,fitnessfriendssugatangnoongnearadgangnagpakitapackagingnakatapattaga-nayonnakaka-inrambutannananaloakmangbighaniabundantelaruinmarasiganmatapobrengganyanthanksgivingawardabutanpumupurimasasabitalagaapologetichawaiistonehamkommunikerercosechar,landlinesay,bulongexperts,humiwalaykilayyeyredesrenaiaeffektivdoble-karainaabotkaharianprincipalesnilangkinabubuhaypagbabagong-anyonakakatandamapaparevolucionadonatinagnilaoskabarkadamatapossoonnagbungaalambrideunannasisiyahansinodidingpanggatongmedikalsabadoumakbaynakahantadkumalmaiyamotmaglalakadimbesmaghintaynaibibigaypamasaheinintaymaghilamosipaliwanagpaghabaprimerosgamitin18thmagdamaganlangkaypaastopnababakasmaitimextrasummerunattendedtrajevasquesmawalahinigituno4thcalleruwaknapatulalalabisiniinomhusogisingmaramoteachhellomedievalnakapikitmininimizetagalogminamasdancoaching:dialledjuegosviewsawsawanbinawianmasdantatlopepemananalodatapwatmakesinfectioussumamaputingiosgitanascontinuednalugmokmakikikainnyamrstutusinprimersalapilumipadevolvedberkeleytungkod