Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

8 sentences found for "consider"

1. As technology continues to advance, it is important to consider the impact it has on society and to find ways to mitigate any negative effects while maximizing its benefits

2. Bias and ethical considerations are also important factors to consider when developing and deploying AI algorithms.

3. Different investment vehicles may be subject to different fees and expenses, and investors should consider these costs when making investment decisions.

4. Investment returns are subject to taxes, and investors should consider the tax implications of their investments.

5. It's important to consider the financial responsibility of owning a pet, including veterinary care and food costs.

6. Research and analysis are important factors to consider when making investment decisions.

7. Risk tolerance is an important factor to consider when deciding how to invest.

8. While it has brought many benefits, it is important to consider the impact it has on society and to find ways

Random Sentences

1. Ibinigay ni Ana ang susi sa kanya.

2. Hindi dapat natin pahintulutan ang paglapastangan sa kapakanan ng mga batang nasa mapanganib na kalagayan.

3. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

4. Hindi maganda ang kanilang plano kaya ako ay tumututol dito.

5. The treatment for leukemia typically involves chemotherapy and sometimes radiation therapy or stem cell transplant.

6. The bag of groceries was too hefty for the elderly woman to carry on her own.

7. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

8. Nagsusulat ako ng mga pangalan sa aking kalendaryo upang hindi ko sila malimutan.

9. The museum offers a variety of exhibits, from ancient artifacts to contemporary art.

10. Kailangan nating magbasa araw-araw.

11. Tumama ang kanan niyang pisngi sa labi ng nabiawang balde.

12. Ang buhawi ay maaaring magdulot ng pagkalbo sa mga puno, pagbagsak ng mga poste ng kuryente, at iba pang pinsala sa imprastruktura.

13. The construction of the building required a hefty investment, but it was worth it in the end.

14. Hindi ko alam kung paano mo ito tatanggap, pero may gusto ako sa iyo.

15. Sa kaibuturan ng kanyang damdamin, mahal niya ang kanyang mga kaibigan.

16. El ballet clásico es una danza sublime que requiere años de entrenamiento.

17. Magtanim ay di biro, maghapong nakayuko.

18. Ang aking kabiyak ay ang aking tahanan, kung saan ako nararamdamanang tunay na pagmamahal at suporta.

19. Kapag mayroong sira sa ngipin, kailangan ng agarang aksyon upang hindi lumala pa ang problema.

20. Ang kanyang bahay sa Kawit ay isa na ngayong pambansang dambana.

21. The sports center offers a variety of activities, from swimming to tennis.

22. La fábrica produjo miles de unidades del producto en solo un mes.

23. Foreclosed properties are often sold at a discounted price, making them an attractive option for real estate investors.

24. Nakisakay ako kay Jose papunta sa airport.

25. Dapat bigyan ng karampatang atensyon ang mga isyu ng sektor ng anak-pawis.

26. Sa pagtulong-tulong ng mga taga-komunidad, nagkaroon kami ng mas maayos na sistema ng basura.

27. Sino ang iniligtas ng batang babae?

28. His films, teachings, and philosophy continue to inspire and guide martial artists of all styles

29. Saan pa kundi sa aking pitaka.

30. It encompasses a wide range of areas, from transportation and communication to medicine and entertainment

31. La armonía entre los instrumentos en la música de Beethoven es sublime.

32. Lumiwanag ang paningin ko sa paliwanag ng guro.

33. I forgot my phone at home and then it started raining. That just added insult to injury.

34. Naglipana ang mga ibon sa hardin ngayong tag-araw.

35. The car might look old, but you can't judge a book by its cover - it's been well-maintained and runs smoothly.

36. Los héroes pueden tener habilidades sobresalientes, pero también muestran compasión y empatía hacia los demás.

37. May bagong promotion ako sa trabaho kaya masayang-masaya ako ngayon.

38. Kapag bukas palad ka, mas maraming taong magmamahal at magtitiwala sa iyo.

39. They are a member of the National Basketball Association (NBA) and play in the Western Conference's Pacific Division.

40. Users can create profiles, connect with friends, and share content such as photos, videos, and status updates on Facebook.

41. Bago pa man maghatinggabi ay dumating nga ang prinsipe at lubos na nalugod ang nag-aalalang prinsesa.

42. Sa dapit-hapon, masarap mag-picnic kasama ang pamilya at kaibigan.

43. Sin agua, los seres vivos no podrían sobrevivir.

44. May konsiyerto ang paaralan at ang mga guro ang magiging bida.

45. At leve med en tung samvittighed kan føre til søvnløshed og andre sundhedsproblemer.

46. All these years, I have been working to make a positive impact on the world.

47. Nasa harap ng bangko ang bus stop.

48. Si Ogor ang kanyang natingala.

49. Sinuman sa kaharian ay walang makapagbigay ng lunas.

50. Mas maganda si Bingbing kaysa kay Jingjing.

Similar Words

Consideredconsiderar

Recent Searches

considerasthmagrinscafeteriabackampliapakikipagbabagkakaininintramurosaltnamataycannaglipanatumahansumalifitgeneratekakilalalumamangpicturespinapalosparemagbibiyahemaaamongatensyonkundimankwartorepresentativebigyanparkeculturalmang-aawitcontrolarlasearlyhanlarangannalamandalhanproductionnagbiyayacarebansasasakyanservicespagongpartybefolkningen,combatirlas,hukaykampeonbaranggaykundilisensyatinaasannilayuansalitangumanohinamatindiumingitomfattendekassingulangapoymakisuyolightkalansagasaansunud-sunodgiverheinagisingconditioningkasinggandafarmmemorialresultapaki-basasumusunoinagawnogensindeabovewealthmakisigmagalitlipadpistayatablazingmakasalanangspaghettipinabulaanadobosambitmagdaancomplexnakatalungkomaaksidenteoverallkaklasegutomsinunodiwanannaglulutoprovidedpagsisimbangxixlamang-lupamrsfar-reachingevolvedpaligsahanhapag-kainanpilitnaglalaronawaladivideswalngkoreanpumansinnatinglalakadlingidtinawagcultivamamahalinkonsyertot-shirtnapagmabatongbritishnobleguitarratitaipagmalaakipangyayarimesangnagpaalamkwenta-kwentatherapeuticsgubatkenjicashshadesmagagawasakenlumiitpedenggawinnaantigpaglalaitarkilakarwahengwanttransmitssystems-diesel-runagricultoreslumilingonpalaysigesagabalkamag-anakryankalongmasaholnanditoformatrelativelyinspiredtibokbroadcastingpantheonmananaogkaswapanganpagtangisexpectationsipihithinigitmasipagnakakamitbestmarketing:prutasedadmauntogshopeekinalalagyanartsreguleringmulmalakingasukaleksaytedmadadalagjortharingmind:efficientpersistent,noonpinag-aralan