Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

8 sentences found for "consider"

1. As technology continues to advance, it is important to consider the impact it has on society and to find ways to mitigate any negative effects while maximizing its benefits

2. Bias and ethical considerations are also important factors to consider when developing and deploying AI algorithms.

3. Different investment vehicles may be subject to different fees and expenses, and investors should consider these costs when making investment decisions.

4. Investment returns are subject to taxes, and investors should consider the tax implications of their investments.

5. It's important to consider the financial responsibility of owning a pet, including veterinary care and food costs.

6. Research and analysis are important factors to consider when making investment decisions.

7. Risk tolerance is an important factor to consider when deciding how to invest.

8. While it has brought many benefits, it is important to consider the impact it has on society and to find ways

Random Sentences

1. Mabait sina Lito at kapatid niya.

2. Mahalaga sa akin na mapaligaya ang aking nililigawan kahit sa maliliit na bagay lamang.

3. We have been married for ten years.

4. Lumaganap ang panaghoy ng mga magsasaka dahil sa kakulangan ng tubig para sa kanilang pananim.

5. Wala ka na bang iba pang gustong puntahan?

6. Nay, ikaw na lang magsaing.

7. Eating healthy is an important way to take care of your body and improve your quality of life.

8. Hi Gelai!! kamusta naman ang paborito kong pamangkin?

9. Repeated frustration can lead to feelings of hopelessness or helplessness.

10. Namnamin natin ang bawat sandali ng bakasyon.

11. I have a tradition of taking a photo every year on my birthday to document how I've changed over time.

12. Sa panahon ng tag-ulan, naglipana ang mga lamok sa amin.

13. Electric cars can support renewable energy sources such as solar and wind power by using electricity from these sources to charge the vehicle.

14. Limitations can be challenging, but they can also inspire creativity and innovation.

15. La robe de mariée est magnifique.

16. Las plantas medicinales se utilizan para elaborar remedios naturales y tratamientos terapéuticos.

17. Ang republika na itinatag niya ang unang demokratikong republika sa Asya.

18. Limitations can be physical, mental, emotional, financial, or social.

19. He is watching a movie at home.

20. Wala na naman kami internet!

21. Nag-ugat sa puso ni Durian na mahalin ang sakop ng kanyang ama.

22. He admires the honesty and integrity of his colleagues.

23. The bakery offers a wide variety of cakes, from classic flavors to unique creations.

24. Ang tubig-ulan ay mahalaga sa pagpapalago ng mga halaman at hayop.

25. Ano ang gustong bilhin ni Juan?

26. Tesla's goal is to accelerate the world's transition to sustainable energy and reduce reliance on fossil fuels.

27. Ang mga karapatan ng mga anak-pawis ay kailangan ipagtanggol at ipaglaban.

28. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

29. La alimentación saludable debe incluir una variedad de proteínas, carbohidratos y grasas saludables.

30. Nakita ni Juan ang paparating na bus kaya’t kumaripas siya para maabutan ito.

31. Sa larangan ng negosyo, ang mailap na customer ay mahirap makuha at panatilihin.

32. Mahirap maging may agam-agam sa buhay dahil ito ay maaaring magdulot ng pagkabalisa.

33. Ang mga kawal nagsisilbi sa bayan upang protektahan ang mamamayan.

34. Natayo ang bahay noong 1980.

35. Oh ano 'to?! Sabi ko mansanas diba hindi saging!

36. Tahimik ang buong bahay, waring walang tao sa loob.

37. Sa Taal, Batangas matatagpuan ang Mabini Ancestral House na pinaniniwalaang bahay-bata ni Apolinario Mabini.

38. Nauntog si Jerome sa kanilang pintuan.

39. Walang 'tayo' Maico. Kaya please lang iwan mo na ako.

40. El invierno marca el final y el comienzo de un nuevo año, lleno de esperanzas y propósitos.

41. Napakabuti nyang kaibigan.

42. Proper identification, such as a collar with a tag or microchip, can help ensure a lost pet is returned to its owner.

43. Sustainable transportation options, such as public transit and electric vehicles, can help reduce carbon emissions and air pollution.

44. At ako'y namulat sa hubad na katotohanan.

45. Ang pag-aaral ng panitikan ay nagbibigay daan sa mas malalim na pag-unawa sa buhay.

46. Nahawa ako ng kuto sa kapatid ko.

47. The chef created a series of dishes, showcasing different flavors and textures.

48. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

49. Scarlett Johansson is a prominent actress known for her roles in movies like "Lost in Translation" and as Black Widow in the Marvel films.

50. Malaya syang nakakagala kahit saan.

Similar Words

Consideredconsiderar

Recent Searches

considerkapasyahanpagpapautanggitanasyeahmartianenfermedades,marchpapagalitanpanghabambuhaypagngitimakauuwiikinasasabikstevenapatulalainatakemagtigilmananalonaglokogumawanaapektuhanlumikhanamumutlainilalabasnapaiyakeconomycreatingikinabubuhaykatawangpinag-usapannapapag-usapaneskwelahanmahahalikkundimanmakuhangkinatatakutannagpabotpinapaloisinumpatumamismahawaankulturnatuwapataynakabibingingna-curiouskatutuboanongjejucountlesstulisaniigibginawaranbangkangkaibigandulotevolucionadosukatplatformautomatiskawahinimas-himastinatanongmagsisimulalungsodasiaticctricasnagplayrightsnakiisamatutongmisyunerongmahahawatamarawpamamasyaladditionally,incidencebalediktoryantrajekanoaustraliaumaapawpanatagkabarkadabulonghongsumingitnatagalanmagnifysinakoptinutopculpritmurangbusyilawwealthadmiredroselleeconomicsaracarmenremaingamitincelularesiatflalakatedraltshirtinantayblognanamanjameswidedollymalapadrabe1787panahonlegislationdalawa1920skatandaanmulreducedfridayschoolsleukemiaipanlinisfar-reachingcongresslungkottsaangpuntastonehampedebalebiroriskdissecardmasaholpuntacontinuedpinag-aralanitinuringdaigdigpartnerresultanitodonetrackactingmonetizingdosformahiminvestingnagmartsainvolvekakaantaykaringi-googlesandokguideclientegenerabamakalaglag-pantyreadmagkahawakbaku-bakongnaghatidligayaencountertemparaturabloggers,kagabisakinabernanunuridatapuwaipaliwanagnahihiloviolencekinauupuangbangladeshnalalaglagiintayinkahaponnakapagsabitulongkasinggandaabalangdaddynahahalinhanvetosharesinasabipagtinginnundiaper