Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "sumasaliw"

1. Ang huni ng mga Kuliglig at kokak ng mga Palaka ay sumasaliw sa awit ng mga Maya.

Random Sentences

1. Después de terminar el trabajo, fuimos a celebrar con nuestros amigos.

2. Habang nagluluto, nabigla siya nang biglang kumulo at sumabog ang kawali.

3. Boboto ako sa darating na halalan.

4. Athena.. gising na. Uuwi na tayo maya maya.

5. La música es un lenguaje universal que trasciende las barreras del idioma y la cultura

6. Il est également important de célébrer les petites victoires en cours de route pour rester motivé.

7. Ang pagsama sa kalikasan ay nagdudulot ng isang matiwasay na kalooban.

8. Tangka na niyang pagbubuhatan ng kamay ang matanda nang biglang lumiwag ang damit ng matanda at nagbago ang kanyang anyo.

9. Cancer treatment can have side effects, such as nausea, hair loss, and weakened immune system.

10.

11. Antiviral medications can be used to treat some viral infections, but there is no cure for many viral diseases.

12. Hockey is known for its physicality, with players often engaging in body checks and other forms of contact during the game.

13. Omelettes are a popular choice for those following a low-carb or high-protein diet.

14. In conclusion, the telephone is one of the most important inventions in human history

15. Nag smile siya sa akin, at nag smile rin ako sa kanya.

16. He has bought a new car.

17. Gustong pumunta ng anak sa Davao.

18. Bawal magdadala ng baril sa loob ng paaralan dahil ito ay delikado sa kaligtasan ng mga estudyante.

19. Sinadyang hindi magsuot ng mahal na damit si Juan sa kanyang pamamamanhikan upang magkaruon ng mas malamig na pakiramdam.

20. Les travailleurs peuvent travailler dans des environnements différents, comme les bureaux ou les usines.

21. Nagtaka ito sa pagbabagong-anyo ni Kiko hanggang maging maliit na hayop na animo'y bayawak.

22. Ang mga kabataan ay naglalaro ng computer games hanggang sa hatinggabi.

23. Mapapansin kaya sa dami ng 'yong ginagawa

24. They do not eat meat.

25. Pneumonia is a serious infection that affects the lungs.

26. Malulungkot siya paginiwan niya ko.

27. Kapag niluluto ni Tatay ang adobo, ang amoy ay sobrang mabango at nakakagutom.

28. Sweetness can be balanced with other flavors to create a harmonious taste experience.

29. The police were trying to determine the culprit behind the burglary.

30. She burned bridges with her friends by spreading gossip about them.

31. I love coming up with creative April Fool's jokes to play on my friends and family - it's a great way to bring a little humor into our lives.

32. I learned early on that there's no such thing as a free lunch - everything comes with a cost.

33. Sapagkat batay sa turo ng Katolisismo ay nagpasan ng krus at ipinako sa kabundukan si HesuKristo.

34. Erfaring har vist mig, at det er vigtigt at have en positiv tilgang til arbejdet.

35. Les systèmes d'intelligence artificielle peuvent être utilisés pour résoudre des problèmes complexes.

36. Facebook Events feature allows users to create, share, and RSVP to events.

37. Dahil sa aksidente sa pagpapatakbo ng negosyo, nagsara ang kumpanya at maraming tao ang nawalan ng trabaho.

38. Hinde na ko nag dalawang isip pang lapitan sila.

39. Ignorieren wir unser Gewissen, kann dies zu einem Verlust unseres moralischen Kompasses führen.

40. I don't like to make a big deal about my birthday.

41. Tumawag ang pamilya ng albularyo upang gumaling ang kanilang kamag-anak mula sa misteryosong sakit.

42. Nagpa-photocopy ng report si Kiko.

43. Aku sayang kamu lebih dari apapun, sayang. (I love you more than anything, darling.)

44. Maraming tao ang dumalo upang manood kung mananalo ang matanda sa batang si Amba.

45. Bestfriend! impit na tili ni Mica habang palapit sa akin.

46. Kapag umuulan, hindi puwedeng maglaba ng mga damit sa labas.

47. Nagreklamo ako tungkol sa pakete ko.

48. La vaccination est un moyen efficace de prévenir les maladies infectieuses et protéger la santé publique.

49. Don't spill the beans about the project, it's supposed to be a secret.

50. Det er vigtigt at være opmærksom på de mulige risici og udføre grundig forskning, før man beslutter sig for at deltage i gamblingaktiviteter.

Recent Searches

sumasaliwkumukulorewardingoutlinebumigayhugismalamangchoosepangalancarmennenadikyamwasaksandalimissionmariabinibilangvivamahinanapakasipagpaghihingaloinasikasomagpagalingnapatayomagsusunuranpagkamanghamagkaibagulatmagpalibreskills,nagbiyayapagngitipanghabambuhaypagpapautangikinatatakotnagmungkahinakumbinsinagre-reviewwishinggumagalaw-galawikinagagalakpagluluksagumawanamataynakapasafilipinapinuntahanpagkatakothitaibinibigayi-rechargeyoutube,makikiligomagpakasalmagsi-skiinginvesting:mahirapnapahintomiyerkulesnakilalanakalockkamiasthanksgivingnakatitiginiindanaglokolalabashuluseguridadmagturomagbibiladkasingmgastrategieskarapatanipinangangakmalilimutanobservation,maligayanagplaysiguropesosde-latakonsyertopabilipigilansaktanbilihincynthiaexigenteestadospakiramdamgenedulotonlineitinagoamotinanggaputilizasentencebinulongmartessumagotaumentarkatandaanzoohuwebesbutchtrafficrestawanpshabonomatindingoliviaabalastill1980burgergatheringsubalitnyaclasesseebabesautomatiseremakilingbilermanysurgeryoutpostheykalayaancompartenphysicalleedemocraticadverselynagreplycornersburdenmillionsirognanlilimahidnaggingabskahoydingdingdoingcomputereslavehatingeyelorenastuffeddaigdigrestlcdimagingfistsspeedpunong-kahoykaloobangmukhamagtigilbathalagulang300naglalatangmisteryokainumiiyakdrogamaytoothbrushnagtatrabahonahuhumalinggjortnapanoodtumatawagbopolsmalungkottabiganidganitopakpakguidemakabilidustpandibabinigaytrentransparentpowernakikini-kinitaadecuadotsehamakmakapangyarihanmatapobrengmasok