Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

11 sentences found for "lee"

1. Born in San Francisco in 1940, Lee was raised in Hong Kong and began training in martial arts at a young age

2. Bruce Lee was a martial artist, actor, and philosopher who is widely considered to be one of the most influential figures in the history of martial arts

3. Hinatid ako ng taksi sa bahay ni Mrs. Lee.

4. In addition to his martial arts skills, Lee was also a talented actor and starred in several films, including The Big Boss, Fists of Fury and Enter the Dragon

5. In addition to his martial arts skills, Lee was also known for his philosophical ideas and his emphasis on personal development

6. In conclusion, Bruce Lee was a martial artist, actor, and philosopher who is widely considered to be one of the most influential figures in the history of martial arts

7. Lee's influence on the martial arts world is undeniable

8. Lee's martial arts skills were legendary, and he was known for his incredible speed, power, and agility

9. These films helped to introduce martial arts to a global audience and made Lee a household name

10. Today, Bruce Lee's legacy continues to be felt around the world

11. Unfortunately, Lee's life was cut short when he died in 1973 at the age of 32

Random Sentences

1. Hinugot niya ang kanyang bag sa ilalim ng mesa.

2. Me gusta comprar chocolates en forma de corazón para mi novio en el Día de San Valentín.

3. Kahit siya ang nauna ay lagi siyang inuunahan ni Ogor sa pagsahod.

4. Tengo náuseas. (I feel nauseous.)

5. Hinanap niya si Pinang.

6. Microscopes have played a critical role in the development of modern medicine and scientific research.

7. Nasa tabi ng ilog, pinagmamasdan niya ang mga isdang naglalaro sa tubig.

8. J'ai acheté un nouveau sac à main aujourd'hui.

9. Ngumiti siya at lumapit kay Maico.

10. Mayroon pa ba kayong gustong sabihin?

11. La música es un lenguaje universal que puede ser entendido por personas de diferentes culturas y lenguas.

12. Mahalagang magbigay ng respeto sa bawat isa, datapapwat ay hindi naman lahat ng tao ay magkakatugma ang mga paniniwala.

13. Forgiveness is a choice that can bring healing and peace to both the forgiver and the one being forgiven.

14. Maraming ideya na ibinibigay ang brainly.

15. The company is exploring new opportunities to acquire assets.

16. Ang tubig-ulan ay maaaring magdulot ng kaguluhan sa mga lugar na hindi handa sa mga pagbabago sa panahon.

17. Cosecha el maíz cuando las espigas estén completamente maduras

18. They organized a marathon, with all proceeds going to charitable causes.

19. Ang ganda pala sa enchanted kingdom!

20. Sa tradisyon ng kanilang kultura, isang malaking kaganapan ang pagpapakilala ng pamilya ng lalaki sa pamilya ng babae sa pamamamanhikan.

21. Buenos días amiga

22. Si Aguinaldo ay nahuli ng mga Amerikano noong 1901 sa Palanan, Isabela.

23. The website's loading speed is fast, which improves user experience and reduces bounce rates.

24. Anong nangyari sayo? Bakit hinde ka nagkakakain?

25. Mens nogle mennesker nyder gambling som en hobby eller en form for underholdning, kan det også føre til afhængighed og økonomiske problemer.

26. Doon nyo sabihin ang gusto nyong sabihin at doon nyo gawin ang gusto nyong gawin

27. "Manalig ka sa Diyos at hindi ka mapapahamak," ani ng pari sa kanyang sermon.

28. Dahil sa pagtaas ng populasyon sa bansa, yumabong ang pagtatayo ng mga condominiums at mga townhouses.

29. El lienzo es la superficie más común utilizada para la pintura.

30. Ang paggamit ng droga ay hindi lamang masamang bisyo, kundi pati na rin isang krimen laban sa iyong sarili at sa lipunan.

31. Les écoles travaillent à fournir un environnement d'apprentissage sûr et inclusif pour tous les étudiants.

32. Umiling lang siya tapos hinawakan yung kamay ko.

33. Actions speak louder than words.

34. Dogs can develop strong bonds with their owners and become an important part of the family.

35. Pedro at Juan ang mga pangalan namin.

36. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

37. En resumen, el teléfono es un dispositivo electrónico que permite la comunicación a distancia mediante el uso de señales de sonido

38. Sa mga lugar na mayroong tag-ulan, kadalasang tumataas ang presyo ng mga prutas at gulay dahil sa hirap sa pag-ani.

39. Binigyan sya ng dentista ng gamot matapos syang bunutan ng ngipin.

40. Ibinigay ko sa kanya ang pagkakataon na magpakilala sa kanyang mga kaisa-isa.

41. Hinahangad ko na makatapos ng yoga session nang hindi naghihingalo.

42. Kayo ang may kasalanan kung bakit nagkaganito ang buhok ko!

43. Have they finished the renovation of the house?

44. May pumupunta sa Seasite minu-minuto.

45. Ako si Rodona ang diwata ng budok na ito.

46.

47. Hvert fødsel er unik og kan have forskellige udfordringer og glæder.

48. Writing a book can be a rewarding experience, whether you are writing for personal fulfillment or to share your knowledge and expertise with others

49. Sumagot agad si Kuya isang ring pa lang.

50. He has been practicing yoga for years.

Similar Words

leeg

Recent Searches

scienceleekansergagambareadingluzetouminomcontrolarlasgitarawebsitecompletejohnprovidedblesslcdumilingeducationalpdamagkasintahannamumulaklaknagtatakboikawkonsiyertonagpasalamatkumitaobra-maestraanibersaryomerlindanagbakasyonuusapanpaladnakatapatnalalabigirlmagpalibrepulang-pulamagamotnatuwapanindatatanggapinnakahaintaglagasarbejdsstyrkenapakahabamagkamaliparinbeautykuwadernoteknologisinasadyakontratapahirambalahibokabutihanhimihiyawbibigyanpumitaskampananabigyancardigangawainkapitbahaynapansinumiiyakiwanantanghaliincitamentermagbigaykaratulangpropesoreconomicriegapneumoniamensdiyaryopinisilbayanitrajeahhhhcurtainshuertojolibeebankmawalabuwayadiapernaiwangumagahumigapulongpasahehounddasaltsupermataasexpresandespuesricodinanasfitumalislistahanplagasteachercarriesviolencevelstandiyanbritishbecameelectoralfinishedmatagumpayhitikdangerouslandofauxnagdarasalpepeiniwancenterredigeringradiocitizenpisohismisaahitlamesakainmariofrescoprovebugtongfireworksjacecommissionsore4thtwinkleencounterimpactnaritohalamanfatnakakasulatcontentilingscalerepresentativekitregularmenteabstainingbluetekstkapatawarantabakinalakihanpaskopinakamagalingmumuramag-plantlotkagyatpanghihiyangiglapmahahawabinge-watchinghanapineksport,aayusinnababalotsagotgulangmariloukambingsaannakatuwaanglinesapatbasatamadtalagakayabutijocelynhundreddumaanniyogbumahatablerabeoperateitimresumennag-replybroughtikinatatakotjose