Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "different"

1. Ailments can impact different organs and systems in the body, such as the respiratory system or cardiovascular system.

2. Ailments can impact different populations disproportionately, such as people of color, women, and those with low socioeconomic status.

3. Baby fever can impact relationships, as partners may have different timelines or desires regarding starting a family.

4. But recently it has been detected that the habit of smoking causes different kinds of serious physical ailments, beginning with coughing, sore throat, laryngitis, and asthma, and ending with such a fatal disease as cancer

5. Cancer can be classified into different stages and types, which determine the treatment plan and prognosis.

6. Cancer can impact different organs and systems in the body, and some cancers can spread to other parts of the body.

7. Different investment vehicles may be subject to different fees and expenses, and investors should consider these costs when making investment decisions.

8. Different investment vehicles offer different levels of liquidity, which refers to how easily an investment can be bought or sold.

9. Different religions have different interpretations of God and the nature of the divine, ranging from monotheism to polytheism and pantheism.

10. Different types of stocks exist, including common stock, preferred stock, and penny stocks.

11. Different types of work require different skills, education, and training.

12. Different? Ako? Hindi po ako martian.

13. Doctor Strange is a sorcerer who can manipulate magic and traverse different dimensions.

14. Electric cars are available in a variety of models and price ranges to suit different budgets and needs.

15. From there it spread to different other countries of the world

16. Hairdressing scissors, also known as shears, have different blade designs for different cutting techniques.

17. He was a master of several different styles, including Wing Chun, boxing, and fencing, and he developed his own style, Jeet Kune Do, which emphasized fluidity and adaptability

18. He was one of the first musicians to popularize rock and roll, and his music and style helped to break down racial barriers and bring different cultures together

19. It's wise to compare different credit card options before choosing one.

20. Mathematics provides a universal language for communication between people of different cultures and backgrounds.

21. Nationalism can be a source of conflict between different groups within a nation-state.

22. Omelettes can be cooked to different levels of doneness, from slightly runny to fully set.

23. Over the years, television technology has evolved and improved, and today, there are a variety of different types of television sets available, including LCD, LED, and plasma TVs

24. Quiero aprender un nuevo idioma para comunicarme con personas de diferentes culturas. (I want to learn a new language to communicate with people from different cultures.)

25. She enjoys cooking a variety of dishes from different cultures.

26. Some coffee enthusiasts enjoy collecting different types of coffee beans and brewing methods to explore the variety of flavors and aromas that coffee has to offer.

27. Some couples choose to have a destination wedding in a different country or location.

28. The chef created a series of dishes, showcasing different flavors and textures.

29. The city hosts numerous cultural festivals and events, celebrating different traditions and communities throughout the year.

30. The company launched a series of new products, targeting different customer segments.

31. The conference brings together a variety of professionals from different industries.

32. The Explore page on Instagram showcases content from various categories such as fashion, food, travel, and more, catering to different interests and preferences.

33. The film director produced a series of short films, experimenting with different styles and genres.

34. The level of sweetness can vary in different types of sugar and sweeteners.

35. The park has a variety of trails, suitable for different levels of hikers.

36. The store offers a variety of products to suit different needs and preferences.

37. There are different types of scissors, such as sewing scissors, kitchen scissors, and craft scissors, each designed for specific purposes.

38. There are many different types of microscopes, including optical, electron, and confocal microscopes.

39. They travel to different countries for vacation.

Random Sentences

1. Bagaimana pendapatmu tentang film yang baru saja tayang? (What is your opinion on the latest movie?)

2. May limang estudyante sa klasrum.

3. The song went viral on TikTok, with millions of users creating their own videos to it.

4. Gambling er en form for underholdning, hvor man satser penge på en chancebaseret begivenhed.

5. Gawa/Yari ang Tshirt sa Tsina.

6. Dialog antaragama dan kerja sama antarumat beragama menjadi penting dalam membangun perdamaian dan keharmonisan di tengah keragaman agama.

7. Aku rindu padamu. - I miss you.

8. Ang pambansang bayani ng Pilipinas ay si Jose Rizal.

9. Sa gitna ng gubat, nagbabaga ang apoy na ginagamit nila upang magluto.

10. Mi amigo del colegio se convirtió en un abogado exitoso.

11. Los powerbanks vienen en diferentes capacidades, que determinan cuántas cargas pueden proporcionar.

12. No me gusta el picante, ¿tienes algo más suave?

13. Anong oras mo gustong umalis ng bahay?

14. Some people find fulfillment in volunteer or unpaid work outside of their regular jobs.

15.

16. Don't worry, it's just a storm in a teacup - it'll blow over soon.

17. Det er vigtigt at have relevant erfaring, når man søger en ny jobposition.

18. Wala akong pakelam, basta nasa ref ng bahay ko akin!

19. Ang galing nya magpaliwanag.

20. Les chimistes travaillent sur la composition et la structure de la matière.

21. Sumungaw ang payat na mukha ng kanyang asawa.

22. The photographer captured a series of images depicting the changing seasons.

23. El perro de mi amigo es muy juguetón y siempre me hace reír.

24. Pakibigay sa tindera ang tamang bayad para hindi siya malugi.

25. Ginagamit ang salitang "waring" upang ipahiwatig ang isang hinuha o tila isang bagay na maaaring totoo, ngunit hindi pa tiyak.

26. Wala namang ibang tao pedeng makausap eh.

27. Pumasok ang mga estudyante sa klase nang limahan.

28. S-sorry. nasabi ko maya-maya.

29. Ligaya ang pangalan ng nanay ko.

30. Mataaas na ang araw nang lumabas si Aling Marta sa bakuran ng kanilang maliit na barung-barong.

31. Hindi ko ho kayo sinasadya.

32. Points are scored when the ball goes through the basket, and the team with the most points at the end of the game wins.

33. Elle peut être interne, c'est-à-dire provenant de soi-même, ou externe, provenant de l'environnement ou de la pression sociale.

34. Dahil sa pagiging maramot, madalang siyang bisitahin ng kanyang mga kaibigan.

35. Imbes na gamitin ang pana para kay Psyche, ay pinabayaan niya lamang itong mamuhay ng normal at tumaliwas sa utos ng ina.

36. La esperanza nos permite ver un futuro mejor y trabajar para hacerlo realidad. (Hope allows us to envision a better future and work towards making it a reality.)

37. Kucing di Indonesia juga sering dibawa ke salon kucing untuk melakukan perawatan bulu dan kesehatan mereka.

38. Yumabong ang interes ng mga kabataan sa pag-aaral ng STEM (Science, Technology, Engineering, at Mathematics) na may magandang kinabukasan.

39. Additionally, television has also been used as a tool for educational programming, such as Sesame Street, which has helped to teach young children reading, writing, and math

40. El orégano es una hierba típica de la cocina italiana, ideal para pizzas y pastas.

41. El cultivo de arroz requiere de un terreno inundado y condiciones climáticas específicas.

42. Shaquille O'Neal was a dominant center known for his size and strength.

43. The Taj Mahal in India is a magnificent wonder of architecture.

44. The internet has also led to the rise of streaming services, allowing people to access a wide variety of movies, TV shows, and music

45. Get your act together

46. Naging tradisyon na sa kanilang baryo ang pagdiriwang ng kaarawan ng kanilang santo.

47. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

48. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

49. Tumulo ang laway niya nang nakita niya ang pinaka-masarap na kakanin na inihain sa kanya.

50. Agad agad din syang tumalikod at tumakbo...

Recent Searches

mitigatedifferentsmallsikrer,grammarberkeleywhetherguidemakasalanangestablishedlagnatinuminbroadcastkendidugolilipadnagpapaniwalanagliwanagikinakatwiranbasakumalmaamuyinmasayangngumiwiintindihintutungoihandapagbaticantidadcontentkomedorsamakatwidpananakitbawatakongiyongtransportationmatabangmadridkalaunansetyembre1954halakhakdiscoveredtrensumarapbisigactivitymagbungagumagalaw-galawnagpatuloynagkwentomakidalomaliksinakapasamagagamitleadersnakarinigsapagkatnatatakothealthierfollowingnaghubadrimastaksikasakitlumbaykarapatanrisenatulogbumabagpumatolsinipangdogimagingjunioforevermakesaffectnamumukod-tanginakakatulongnag-aalanganikinasasabikmagkaibiganbangladeshdiscipliner,pagtawababasahinmaipagmamalakingstrategiesmagsisimularektanggulotumamistinungonahigitanumikotkassingulangvitaminnawalakasalukuyangsikatmatikmanbuhoksagapproductspublicationgreenhillsbinatangmuligheder1950sgiveownmaitimcleanmuchosgabeseekmapapangpuntaipinagbilingpatrickrelievedawaremagtatagalmagkikitamagpalibrekalakihanmeriendanabalitaannagpapakainnagpapasasainasikasonakikianag-alalaumiiyaktatlumpungnagawangkinakabahanincluirpaghuhugasjuegosgovernmentmedicineactualidadmagpagupitdeliciosanaabutanmanghikayatnapanoodpagtataasnakatuloggayunpamanallowedtitanakabawitumatanglawmawawalapagpanhikatensyongkamakailannai-dialnakilalakuripotbowlmakapagempakemanahimikmagdamagdapit-haponsana-alldamdaminwriting,habitskampanakasamaangnapansinpinipilitnasilawmagdalaeksport,sandwichtanyagginoongsubject,gubatbefolkningenmasayarecibirflamencoanumanmaligayanangingilidrequierenmakatiberetiayasocialebundokmariloukakayanangkina