Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "different"

1. Ailments can impact different organs and systems in the body, such as the respiratory system or cardiovascular system.

2. Ailments can impact different populations disproportionately, such as people of color, women, and those with low socioeconomic status.

3. Baby fever can impact relationships, as partners may have different timelines or desires regarding starting a family.

4. But recently it has been detected that the habit of smoking causes different kinds of serious physical ailments, beginning with coughing, sore throat, laryngitis, and asthma, and ending with such a fatal disease as cancer

5. Cancer can be classified into different stages and types, which determine the treatment plan and prognosis.

6. Cancer can impact different organs and systems in the body, and some cancers can spread to other parts of the body.

7. Different investment vehicles may be subject to different fees and expenses, and investors should consider these costs when making investment decisions.

8. Different investment vehicles offer different levels of liquidity, which refers to how easily an investment can be bought or sold.

9. Different religions have different interpretations of God and the nature of the divine, ranging from monotheism to polytheism and pantheism.

10. Different types of stocks exist, including common stock, preferred stock, and penny stocks.

11. Different types of work require different skills, education, and training.

12. Different? Ako? Hindi po ako martian.

13. Doctor Strange is a sorcerer who can manipulate magic and traverse different dimensions.

14. Electric cars are available in a variety of models and price ranges to suit different budgets and needs.

15. From there it spread to different other countries of the world

16. Hairdressing scissors, also known as shears, have different blade designs for different cutting techniques.

17. He was a master of several different styles, including Wing Chun, boxing, and fencing, and he developed his own style, Jeet Kune Do, which emphasized fluidity and adaptability

18. He was one of the first musicians to popularize rock and roll, and his music and style helped to break down racial barriers and bring different cultures together

19. It's wise to compare different credit card options before choosing one.

20. Mathematics provides a universal language for communication between people of different cultures and backgrounds.

21. Nationalism can be a source of conflict between different groups within a nation-state.

22. Omelettes can be cooked to different levels of doneness, from slightly runny to fully set.

23. Over the years, television technology has evolved and improved, and today, there are a variety of different types of television sets available, including LCD, LED, and plasma TVs

24. Quiero aprender un nuevo idioma para comunicarme con personas de diferentes culturas. (I want to learn a new language to communicate with people from different cultures.)

25. She enjoys cooking a variety of dishes from different cultures.

26. Some coffee enthusiasts enjoy collecting different types of coffee beans and brewing methods to explore the variety of flavors and aromas that coffee has to offer.

27. Some couples choose to have a destination wedding in a different country or location.

28. The chef created a series of dishes, showcasing different flavors and textures.

29. The city hosts numerous cultural festivals and events, celebrating different traditions and communities throughout the year.

30. The company launched a series of new products, targeting different customer segments.

31. The conference brings together a variety of professionals from different industries.

32. The Explore page on Instagram showcases content from various categories such as fashion, food, travel, and more, catering to different interests and preferences.

33. The film director produced a series of short films, experimenting with different styles and genres.

34. The level of sweetness can vary in different types of sugar and sweeteners.

35. The park has a variety of trails, suitable for different levels of hikers.

36. The store offers a variety of products to suit different needs and preferences.

37. There are different types of scissors, such as sewing scissors, kitchen scissors, and craft scissors, each designed for specific purposes.

38. There are many different types of microscopes, including optical, electron, and confocal microscopes.

39. They travel to different countries for vacation.

Random Sentences

1. Si Tom ay masipag sa trabaho, datapwat hindi marunong mag-ayos ng kanyang mga gamit.

2. A couple of students raised their hands to ask questions during the lecture.

3. Ang mga bayani ay nagbibigay inspirasyon sa mga kabataan upang maging mabuting mamamayan.

4. Alam ko na hindi maganda ang agam-agam ko, kaya kailangan kong magsumikap upang malunasan ito.

5. The patient's prognosis for leukemia depended on various factors, such as their age, overall health, and response to treatment.

6. Eksport af fødevarer fra Danmark er en vigtig del af landets økonomi.

7. He set up a charitable trust to support young entrepreneurs.

8. Mahirap makita ang liwanag sa gitna ng mailap na kadiliman.

9. Lumabas siya upang magmuni-muni sa oras ng takipsilim.

10. Además, el teléfono ha sido una herramienta valiosa en la venta telefónica y en la realización de encuestas

11. Ito rin ang parusang ipinataw ng di binyagang datu sa paring Katoliko.

12. The legend of Santa Claus, a beloved figure associated with Christmas, evolved from the story of Saint Nicholas, a Christian bishop known for his generosity and kindness.

13. Ang paggamit ng droga ay maaaring magdulot ng mga epekto sa kalusugan ng sanggol kung ang isang buntis na babae ay gumagamit ng droga.

14. Magkapareho ang kulay ng mga damit.

15. Nang matanggap ko ang taos-pusong paghingi ng tawad, ang aking galit ay napawi at nagkaroon kami ng pagkakasunduan.

16. Basketball is a team sport that originated in the United States in the late 1800s.

17. Sa tradisyon ng kanilang kultura, isang malaking kaganapan ang pagpapakilala ng pamilya ng lalaki sa pamilya ng babae sa pamamamanhikan.

18. Kinasuklaman ako ni Pedro dahil sa ginawa ko.

19. Huwag kang mag-focus sa kababawan ng isang tao, tingnan mo ang kanyang kalooban.

20. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

21. Dedication is what separates those who dream from those who turn their dreams into reality.

22. Inflation kann auch durch eine Erhöhung der Steuern verursacht werden.

23. Ikaw pala, Katie! Magandang hapon naman.

24. We didn't start saving for retirement until our 40s, but better late than never.

25. Twinkle, twinkle, little star.

26. B-bakit mo pinatay yung ilaw?! biglang tanong ni Cross.

27. Tumayo na sya, Ok! I'll be going now, see you tomorrow!

28. Ang abuso sa kapangyarihan ay nagdulot ng katiwalian sa pamahalaan.

29. Anong nangyari sayo? Bakit hinde ka nagkakakain?

30. Sa matinding takot ay nagsunuran ang mga mangingisda sa di nila nakikilalang matanda.

31. The stuntman performed a risky jump from one building to another.

32. Nagsusulat ako ng mga pangako sa aking mga minamahal sa mga espesyal na okasyon.

33. Sudah makan? - Have you eaten yet?

34. Sa gitna ng bukid, natatanaw ko ang mga kalabaw na umaararo sa lupang sakahan.

35. Lumiit ito at nagkaroon ng mga mahahabang paa.

36. Ang kundiman ay nagbibigay-buhay sa mga alaala ng pag-ibig na nagdaan.

37. Les salaires varient considérablement en fonction des métiers et des secteurs d'activité.

38. Ang hinagpis ng isang ina ay dama sa kanyang bawat hikbi habang inaalala ang kanyang nawalang anak.

39. Ayaw na rin niyang ayusin ang kaniyang sarili.

40. Some fruits, such as strawberries and pineapples, are naturally sweet.

41. Ang abilidad sa pangangalaga ng kalusugan ay mahalaga upang mapanatili ang malusog na pamumuhay.

42. Ininom ni Henry ang kape sa kusina.

43. La realidad puede ser sorprendente y hermosa al mismo tiempo.

44. My sister gave me a thoughtful birthday card.

45. Dalhan ninyo ng prutas si lola.

46. The Constitution divides the national government into three branches: the legislative, executive, and judicial branches

47. Natatanaw na niya ngayon ang gripo.

48. Isang araw, habang nangangahoy si Mang Kandoy, nakakita ito ng isang kweba sa gitna ng kagubatan.

49. Kumakain ng tanghalian sa restawran

50. Leukemia can affect people of all ages, although it is more common in children and older adults.

Recent Searches

clientesdifferentulohealthiermagkaibiganreserbasyonpamanhikanalas-treskubyertosnaglakadtumahimikpagsumamoestudyantesasamahangiyerapagkatakotexhaustionmatasilayairportpaciencianakilalanakasakitwatawatnagsilapitpakukuluancoincidencelumipadnasunogmunangsinisikauntingipingkapainfitinulitdinanaspiecesdietxixsufferipagamotoliviaitakexperiencessumapitlegislativefaultsimplengeffectsmakalaglag-pantymakatatlouugud-ugodnaibibigaypinamalagihitahumahangospinapasayamahahanaysakristanpaghihingalosimonnagtitindamedya-agwagayunmannagpakitagayunpamanculturadistansyasikodraybersangaoutlineunangdisenyongnagsasagotnaguguluhangmatapobrengtobaccosalamangkerofilmsikre,nagulatkinauupuangbayawaknaglahokulunganmananaloumiinommagtataaspagdudugomakasalanangmagkakaroongumagamitmahiwaganahahalinhanhahahahagdananinilabasmusicalespumayagnapatulalasaan-saanpamagatpanindaimprovenakisakayrewardingpapalapitculturessilid-aralanmahabolsugatangbusiness:nagtapostiyakpagsahodnakapikitlilipadisubobanalisinamatsinainspirationtalinopaliparinmatandangnuevosmariebulongbumangonbarangaysisipainnatitirapakainintataascurtainsganyanahhhhaddictioncarriesmatayoghangintsuperkirotforskelmusicianssmilebaryosellingelectorallivesbagaykarangalaniskedyulcnicomaingattrajeinalagaanlistahaniikligoodeveningmapahamakfamecassandraiyanumaagoshugishinoganywhereairconeffektivpeaceresignationpinatidbagyobilaoiniinombiglasnasuccessmayroonsumabogeffortscryptocurrency:katabinglegendsnahulimedievalminutotoothbrushreservesbabesnami-missbugtongscientist10thmalinismajorcard