Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "different"

1. Ailments can impact different organs and systems in the body, such as the respiratory system or cardiovascular system.

2. Ailments can impact different populations disproportionately, such as people of color, women, and those with low socioeconomic status.

3. Baby fever can impact relationships, as partners may have different timelines or desires regarding starting a family.

4. But recently it has been detected that the habit of smoking causes different kinds of serious physical ailments, beginning with coughing, sore throat, laryngitis, and asthma, and ending with such a fatal disease as cancer

5. Cancer can be classified into different stages and types, which determine the treatment plan and prognosis.

6. Cancer can impact different organs and systems in the body, and some cancers can spread to other parts of the body.

7. Different investment vehicles may be subject to different fees and expenses, and investors should consider these costs when making investment decisions.

8. Different investment vehicles offer different levels of liquidity, which refers to how easily an investment can be bought or sold.

9. Different religions have different interpretations of God and the nature of the divine, ranging from monotheism to polytheism and pantheism.

10. Different types of stocks exist, including common stock, preferred stock, and penny stocks.

11. Different types of work require different skills, education, and training.

12. Different? Ako? Hindi po ako martian.

13. Doctor Strange is a sorcerer who can manipulate magic and traverse different dimensions.

14. Electric cars are available in a variety of models and price ranges to suit different budgets and needs.

15. From there it spread to different other countries of the world

16. Hairdressing scissors, also known as shears, have different blade designs for different cutting techniques.

17. He was a master of several different styles, including Wing Chun, boxing, and fencing, and he developed his own style, Jeet Kune Do, which emphasized fluidity and adaptability

18. He was one of the first musicians to popularize rock and roll, and his music and style helped to break down racial barriers and bring different cultures together

19. It's wise to compare different credit card options before choosing one.

20. Mathematics provides a universal language for communication between people of different cultures and backgrounds.

21. Nationalism can be a source of conflict between different groups within a nation-state.

22. Omelettes can be cooked to different levels of doneness, from slightly runny to fully set.

23. Over the years, television technology has evolved and improved, and today, there are a variety of different types of television sets available, including LCD, LED, and plasma TVs

24. Quiero aprender un nuevo idioma para comunicarme con personas de diferentes culturas. (I want to learn a new language to communicate with people from different cultures.)

25. She enjoys cooking a variety of dishes from different cultures.

26. Some coffee enthusiasts enjoy collecting different types of coffee beans and brewing methods to explore the variety of flavors and aromas that coffee has to offer.

27. Some couples choose to have a destination wedding in a different country or location.

28. The chef created a series of dishes, showcasing different flavors and textures.

29. The city hosts numerous cultural festivals and events, celebrating different traditions and communities throughout the year.

30. The company launched a series of new products, targeting different customer segments.

31. The conference brings together a variety of professionals from different industries.

32. The Explore page on Instagram showcases content from various categories such as fashion, food, travel, and more, catering to different interests and preferences.

33. The film director produced a series of short films, experimenting with different styles and genres.

34. The level of sweetness can vary in different types of sugar and sweeteners.

35. The park has a variety of trails, suitable for different levels of hikers.

36. The store offers a variety of products to suit different needs and preferences.

37. There are different types of scissors, such as sewing scissors, kitchen scissors, and craft scissors, each designed for specific purposes.

38. There are many different types of microscopes, including optical, electron, and confocal microscopes.

39. They travel to different countries for vacation.

Random Sentences

1. Maganda ang mga bulaklak sa tagsibol.

2. Hendes karisma er så fascinerende, at alle omkring hende bliver tiltrukket af hende. (Her charisma is so fascinating that everyone around her is drawn to her.)

3. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

4.

5. Maria, si Ginang Cruz. Guro ko siya.

6. De har gjort det muligt for os at automatisere mange af vores daglige opgaver og øge vores produktivitet

7. Las hojas de la hierbabuena se pueden usar para hacer té o mojitos.

8. Nakilala ko ang taong pinapangarap ko kaya masayang-masaya ako ngayon.

9. Sa dapit-hapon, masarap mag-meditate at mag-isip-isip sa mga bagay-bagay.

10. Alam ko na mayroong magandang intensyon ang kanilang plano, ngunit hindi ako sang-ayon dito kaya ako ay tumututol.

11. Eating a balanced diet can increase energy levels and improve mood.

12. Sa bawat pagsubok na dumarating, palaging may aral na natututunan.

13. Sa larangan ng negosyo, ang mailap na customer ay mahirap makuha at panatilihin.

14. Si Rizal ay isang maalam na mag-aaral na nag-aral sa Unibersidad ng Santo Tomas, Unibersidad ng Madrid, at Unibersidad ng Heidelberg.

15. Actions speak louder than words.

16. Hindi ko alam kung paano ko malalampasan ang aking mga agam-agam tungkol sa aking trabaho.

17. Dalam menghadapi tantangan, penting untuk memiliki dukungan sosial dan lingkungan yang positif.

18. He was hospitalized for pneumonia and was on a ventilator for several days.

19. Ang lugar na iyon ay tila isinumpa.

20. Bilin ni Aling Pising na lagi niyang aayusin ang kaniyang buhok upang hindi maging sagabal sa kaniyang mga gawain at pag-aaral.

21. Puwedeng gamitin ang pagguhit upang mag-drawing ng mga bagay na gusto mong ma-achieve sa buhay.

22. Ang aso ni Lito ay kulay puti.

23. Satu titik hitam bisa merusak noda yang putih.

24. ¿Qué edad tienes?

25. En el legado de Da Vinci se encuentra una gran cantidad de cuadernos y dibujos de sus estudios.

26. Sa aming pagdiriwang ng buwan ng wika, nagkaroon kami ng pagtatanghal na nagpapakita ng kahalagahan ng bayanihan.

27. Wala ka naman palang pupuntahan eh, tara na lang umuwi na!

28. Las plantas perennes viven durante varios años, renovando sus hojas y flores de forma periódica.

29. Ang pagtatayo o pagsali sa isang komunidad o samahan ay nakagagamot sa aking pakiramdam ng pagka-bahagi at pagkakakilanlan.

30. Naging mas makapal nga ang buhok ni Rabona.

31. Sakay na! Saan ka pa pupunta?!!

32. We have completed the project on time.

33.

34. Dahil sa pagtatapos ng isang mahabang relasyon, siya ay puno ng lungkot at panghihinayang.

35. Maarte siya sa mga klaseng pagkain kaya hindi siya nakikisabay sa mga inuman sessions.

36. Electric cars have lower maintenance costs as they have fewer moving parts than gasoline-powered cars.

37. Tiyakan ang kanyang pagkakapagsalita; ibig niyang sa pagkalito ng bata sa pag-aapuhap ng isasagot ay masukol niyang buung-buo.

38. Bumalik siya sa Pilipinas nang biglaan dahil may emergency sa kanilang pamilya.

39. Pinahiram ko ang aking gamit pang-camping sa mga kaibigan ko para sa aming weekend getaway.

40. Nakakatuwa ang maliliit na kubyertos na ibinibigay sa mga bata sa mga children's party.

41. La lavanda es una hierba que se utiliza en aromaterapia debido a su efecto relajante.

42. Sang-ayon ako na dapat natin pagtuunan ng pansin ang kalagayan ng ating kalikasan.

43. I know things are difficult right now, but hang in there - it will get better.

44. Sa bawat desisyon na ating ginagawa, kailangan nating isaalang-alang ang bawat posibilidad, samakatuwid.

45. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

46. Hanggang ngayon, ginagamit ang kanyang mga kontribusyon bilang inspirasyon sa pakikibaka para sa kalayaan.

47. Not only did he crash my car, but he also tried to blame me for it. That just added insult to injury.

48. Ang nagdudumaling laro ng chess ay nangangailangan ng matinding kasanayan sa pagtatanghal ng mga hakbang at galaw.

49. Napagod si Clara sa bakasyon niya.

50. Bigla, ubos-lakas at nag-uumiri siyang umigtad.

Recent Searches

adaptabilitydifferentestablishedfournamungafeedbacksetscirclecountlessnaririnigstoplightmarketplacesmagnakawmakakasahodpangungutyawalkie-talkienakapamintanamagbabakasyonpunongkahoygobernadorginugunitakababayannagsasagotnagtuturosalemaihaharapkinikilalangmalezanagbiyayapaki-translatemangangahoykasangkapannagandahannagmakaawakinauupuanmiramahiwagangnakaririmarimmahahanaypinagkiskispagkahapopinahalataaanhinhinawakankumikiniglumabasnahihiyangnaguguluhanimportumagaluugud-ugodbayawaksunud-sunuranaktibistaisasabadpronounnagliwanagsakristantotoosapatoscanteenkristokulturumiibigpaossuzettenavigationtumigilmasagananglagnatnagbibirolalonghalu-halomagbantaygumawakinasisindakanpresidentenecesariofestivalestatagalstrategiesinvestlalakisamfundkalikasanbalediktoryandesisyonanmagpapigilthanksgivingsundaloartistnapapansinlumibotapatnapuwatawatkalakipamilyaarturogrocerymetodiskpauwimartiannaglabamaibamusicaleroplanotaksikundimankoreakontralookedfollowingmakalingnakabaonmarangalininomdisensyonangingisayiniirog1970stumingalahinalungkatparusahantuyomasipagpalakasisterituturokahusayanpagputinapapikithelpedmatitigasiyakyorkenerosisipainanumannandiyanawitinisipankubobanlagnanoode-commerce,nilayuanbiyernesgloriasementoforskelligetalagaestatealaktinapaymayabongself-defensenapapatinginkinamanilamusicianslasatamadentertainmentginaganoonilocosdissemakahingipatunayanmatabangkalonglaronghundredinangthankrenatocelularesxixhmmmmlotlalaasocasasuotpancittrenaniyalarotonightcellphoneayonbarrocoisipipapaputoldalawaeducativastoretelaryngitis00amcalciumnakasuot