Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "create"

1. Accomplishing a long-term goal can create a sense of euphoria and relief.

2. AI algorithms can be used to create personalized experiences for users, such as personalized recommendations on e-commerce websites.

3. As the eggs cook, they are gently folded and flipped to create a folded or rolled shape.

4. Climbing to the top of a mountain can create a sense of euphoria and achievement.

5. Completing a difficult puzzle or solving a complex problem can create a sense of euphoria.

6. Confocal microscopes use laser technology to create 3D images of small structures.

7. Dedication to a cause can mobilize communities, create social change, and make a difference in the world.

8. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

9. Emphasis can also be used to create a sense of urgency or importance.

10. Emphasis can be used to create a memorable and impactful message.

11. Emphasis can be used to create a sense of drama or suspense.

12. Emphasis can be used to create rhythm and cadence in language.

13. Facebook Events feature allows users to create, share, and RSVP to events.

14. Facebook Pages allow businesses, public figures, and organizations to create a public presence and interact with their audience.

15. Facebook provides tools for businesses to create and manage advertisements, track analytics, and engage with their target audience.

16. Green Lantern wields a power ring that allows him to create energy constructs based on his imagination.

17. His invention was an improvement over earlier attempts to create a long-distance communication device, such as the telegraph, which could only transmit messages in Morse code

18. I've found that sharing a personal story is a great way to break the ice and create a connection with others.

19. It can be helpful to create an outline or a mind map to organize your thoughts

20. It can create a sense of urgency to conceive and can lead to conversations and decision-making around fertility, adoption, or other means of becoming parents.

21. Many workplaces prioritize diversity, equity, and inclusion to create a more welcoming and supportive environment for all employees.

22. Receiving good news can create a sense of euphoria that can last for hours.

23. Receiving recognition for hard work can create a sense of euphoria and pride.

24. Seeing a favorite band perform live can create a sense of euphoria and excitement.

25. Seeing a long-lost friend or family member can create a sense of euphoria and happiness.

26. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

27. Supporting policies that promote environmental protection can help create a more sustainable future.

28. Sweetness can be balanced with other flavors to create a harmonious taste experience.

29. Sweetness can be used to mask other flavors and create a more palatable taste.

30. Taking a vacation to a beautiful location can create a sense of euphoria and relaxation.

31. Taking part in an activity that you are passionate about can create a sense of euphoria and fulfillment.

32. The TikTok generation is reshaping the way we consume and create content, with short-form videos becoming the new norm.

33. TikTok is a social media platform that allows users to create and share short-form videos.

34. Uncertainty can create opportunities for growth and development.

35. Users can create an account on Instagram and customize their profile with a profile picture, bio, and other details.

36. Users can create and customize their profile on Twitter, including a profile picture and bio.

37. Users can create profiles, connect with friends, and share content such as photos, videos, and status updates on Facebook.

38. While baby fever can be a powerful and overwhelming experience, it is a natural part of the human desire to create and nurture life.

39. Winning a lottery or a big prize can create a sense of euphoria and disbelief.

Random Sentences

1. Labis na ikinatuwa ng mag-asawa ang biyayang ito,pangalanan nila ang bata na Rabona, pinaghalo ang pangalan ni Rodona at ang bundok ng Rabba.

2. Ketika menghadapi tantangan hidup, penting untuk menjaga keseimbangan antara kerja keras dan istirahat yang cukup.

3. Balancing calorie intake and physical activity is important for maintaining a healthy weight.

4. Magsasalita pa sana siya nang biglang may dumating.

5. Magdamag na bukas ang ilaw sa kwarto.

6. Naglalakad kami sa baybayin ng dagat sa hatinggabi at nasisilayan namin ang magandang tanawin ng buwan.

7. Bakit ka natawa? Bakit ka nakangiti?

8. Tanging si Tarcila lang ang walang imik ngunit malalim ang iniisip.

9. She is studying for her exam.

10. Claro que te apoyo en tu decisión, confío en ti.

11. The vertical axis of an oscilloscope represents voltage, while the horizontal axis represents time.

12. Eeeehhhh! nagmamaktol pa ring sabi niya.

13. Sang-ayon ako na kailangan nating magtulungan upang malutas ang mga suliranin ng ating lipunan.

14. Ako ay nagtatanim ng mga halaman sa aking bakuran.

15. Wonder Woman wields a magical lasso and bracelets that can deflect bullets.

16. Begyndere bør starte langsomt og gradvist øge intensiteten og varigheden af ​​deres træning.

17. Puwede bang pahiram ng asukal? Magluluto ako ng cake mamaya.

18. Ang pag-asa ay nagbibigay ng pagkakaisa sa mga tao sa kanilang pangarap at mga layunin sa buhay.

19. Wives can be loving, supportive, and caring companions to their spouses.

20. Ailments can be a result of lifestyle choices, such as smoking or excessive alcohol consumption.

21. Ibig niyang maranasan ang mga bagay na kaiba sa kinalakihan.

22. ¿Qué le puedo regalar a mi novia en el Día de San Valentín?

23. Napakagaling nyang mag drawing.

24. Mon fiancé et moi avons choisi nos alliances ensemble.

25. Ang abilidad na makisama sa iba't ibang tao ay isang mahalagang aspeto ng liderato.

26. Sa gabi ng handaan ay ipinatawag ng Ada ang lahat ng hayop at halaman.

27. "You can't teach an old dog new tricks."

28. Nakumbinsi niya ang mga ibon at siya ay isinama sa kanilang pagdiriwang.

29. Puwede ba tayong magpa-picture na magkasama?

30. Ang mga halaman ay dapat na pinapakain sa regular na may compost o fertilizer upang matiyak na sila ay may sapat na nutrients para sa paglaki

31. El powerbank es una solución conveniente para cargar teléfonos móviles, tabletas u otros dispositivos en movimiento.

32. Amazon's revenue was over $386 billion in 2020, making it one of the most valuable companies in the world.

33. Isang beses naman ay ang sandok ang hinahanap.

34. Nag-iisa man siya, hindi siya nawawalan ng pag-asa.

35. The sports center offers a variety of activities, from swimming to tennis.

36. Ako ay nagtatanim ng mga puno sa aming lugar upang mapanatili ang kalikasan.

37. Ang malakas na tunog ng sirena ay binulabog ang katahimikan ng lungsod.

38. Nous avons opté pour une cérémonie de mariage intime.

39. Sa kabila ng panganib, nangahas ang grupo na pumasok sa nasusunog na gusali upang may mailigtas.

40. Maraming Pinoy ang nagta-trabaho sa ibang bansa bilang OFW.

41. Ano ang gusto mo, sinigang o adobo?

42. Omelettes are a popular choice for those following a low-carb or high-protein diet.

43. Hindi ba nagdaramdam ang nanay at tatay mo?

44. Natalo ang soccer team namin.

45. Umalis siya papuntang Cebu kahapon ng hapon.

46. Sa mga kasal, kadalasan ay mayroong programa ng sayawan upang mas masaya ang pagdiriwang.

47. Dwayne "The Rock" Johnson is a former professional wrestler turned actor, known for his roles in films like "Jumanji" and the "Fast & Furious" franchise.

48. Pasasaan ba't di iikli ang pila? naisip niya.

49. Nasa ganito siyang kalagayan nang bigla niyang maramdaman ang isang ubos-lakas na sipa sa kanyang pigi.

50. Ang buhawi ay maaaring magdulot ng matinding pagkasira sa kagubatan at kapaligiran dahil sa malakas na hangin at pag-ulan.

Similar Words

created

Recent Searches

createnagdiretsohabitsinunud-ssunodkabangisandatapwatpagmasdanpinakamasayaumiwasdiagnosesconcernspasensiyabulaklakmakapagsalitauniversitynakakabangonmauupolamangpersonalsampungipinadalatumahanhalamananthonydontanimoyahasnaniwalanapakagandanguniversalmatarikmasaganangrimasmagtipidpuntahanmamitasbargrowalas-diyesbeautifulpanunuksoikinagagalakkumakantabeingkawalantablebaultiboknakatawagtransmitsnakabluelikaspagkapasanjapansinkintroductiondumagundongfoundcreditofte1990katandaankumpunihincubapinsansusunodmovingpinag-usapanmakatulogpaskomagpa-paskopaskongnewspaperspunung-kahoysinasabikatagalbirthdaynasuklamtinignanmaasahanbibisitanamepagka-diwatapresentationumiyakasongafternoontwo-partymakingadoboAniyaperonagpalitretirarbranchesbingohinanaptanongnatakotbanaldatingdalhinewanmichaeltagsibolwhatevergranadaagaw-buhayulanmabaittanggapinlcdmedicineboyetproblemamaniwalahappypalipat-lipatanungganyanpakilagayviewstungkollumikhamandirigmanganumangmahabananglangkayiconfertilizerbuongmagitingbasahannitongprinsesapinaeffectsallyumagawakinmarilouyoutubegulolibrehoneymoonersgatoladditionallydahileleksyonmississippimatulunginbroadcastskapiranggotkasinababalotlungsodtaasincluirtotoolumipaskaloobangparangdrogakirbysinumantagalabamakapagmanehocampaignsfallaalbularyoabonomagsasakamegetamerikamarchsundhedspleje,labissistemakaliwaabotnagdaraaneditkumunotagam-agampumiliinantokpalagingerrors,dahan-dahanpangalanheartbreaktinutopstatustamaanrobertitsuraninumanalamlegacy