Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "create"

1. Accomplishing a long-term goal can create a sense of euphoria and relief.

2. AI algorithms can be used to create personalized experiences for users, such as personalized recommendations on e-commerce websites.

3. As the eggs cook, they are gently folded and flipped to create a folded or rolled shape.

4. Climbing to the top of a mountain can create a sense of euphoria and achievement.

5. Completing a difficult puzzle or solving a complex problem can create a sense of euphoria.

6. Confocal microscopes use laser technology to create 3D images of small structures.

7. Dedication to a cause can mobilize communities, create social change, and make a difference in the world.

8. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

9. Emphasis can also be used to create a sense of urgency or importance.

10. Emphasis can be used to create a memorable and impactful message.

11. Emphasis can be used to create a sense of drama or suspense.

12. Emphasis can be used to create rhythm and cadence in language.

13. Facebook Events feature allows users to create, share, and RSVP to events.

14. Facebook Pages allow businesses, public figures, and organizations to create a public presence and interact with their audience.

15. Facebook provides tools for businesses to create and manage advertisements, track analytics, and engage with their target audience.

16. Green Lantern wields a power ring that allows him to create energy constructs based on his imagination.

17. His invention was an improvement over earlier attempts to create a long-distance communication device, such as the telegraph, which could only transmit messages in Morse code

18. I've found that sharing a personal story is a great way to break the ice and create a connection with others.

19. It can be helpful to create an outline or a mind map to organize your thoughts

20. It can create a sense of urgency to conceive and can lead to conversations and decision-making around fertility, adoption, or other means of becoming parents.

21. Many workplaces prioritize diversity, equity, and inclusion to create a more welcoming and supportive environment for all employees.

22. Receiving good news can create a sense of euphoria that can last for hours.

23. Receiving recognition for hard work can create a sense of euphoria and pride.

24. Seeing a favorite band perform live can create a sense of euphoria and excitement.

25. Seeing a long-lost friend or family member can create a sense of euphoria and happiness.

26. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

27. Supporting policies that promote environmental protection can help create a more sustainable future.

28. Sweetness can be balanced with other flavors to create a harmonious taste experience.

29. Sweetness can be used to mask other flavors and create a more palatable taste.

30. Taking a vacation to a beautiful location can create a sense of euphoria and relaxation.

31. Taking part in an activity that you are passionate about can create a sense of euphoria and fulfillment.

32. The TikTok generation is reshaping the way we consume and create content, with short-form videos becoming the new norm.

33. TikTok is a social media platform that allows users to create and share short-form videos.

34. Uncertainty can create opportunities for growth and development.

35. Users can create an account on Instagram and customize their profile with a profile picture, bio, and other details.

36. Users can create and customize their profile on Twitter, including a profile picture and bio.

37. Users can create profiles, connect with friends, and share content such as photos, videos, and status updates on Facebook.

38. While baby fever can be a powerful and overwhelming experience, it is a natural part of the human desire to create and nurture life.

39. Winning a lottery or a big prize can create a sense of euphoria and disbelief.

Random Sentences

1.

2. Noon di'y nangalaglag ang lahat ng mga bunga ng punong-kahoy at natabunan ang katawan ni Sangkalan.

3. Dogs are often referred to as "man's best friend".

4. Nasa akin pa rin ang huling halakhak.

5. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

6. Donald Trump is a prominent American businessman and politician.

7. Binabasa niya ng pahapyaw ng kabuuan ng seleksyon at nilalaktawan ang hindi kawili-wili

8. Hinanap nito si Bereti noon din.

9. Nagbabaga ang araw sa gitna ng tanghali, dahilan upang mabilis na matuyo ang mga damit.

10. They are attending a meeting.

11. Representatives are individuals chosen or elected to act on behalf of a larger group or constituency.

12. Maaliwalas ang simoy ng hangin sa probinsya.

13. Mi esposo me llevó a cenar en un restaurante elegante para el Día de los Enamorados.

14. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

15. Electric cars are part of a larger movement toward sustainable transportation, which includes public transportation, biking, and walking, to reduce the environmental impacts of transportation.

16. Seek feedback, it will help you to improve your manuscript

17. Sa ganang iyo, ano ang pinakamagandang gawin upang mapaunlad ang ating bayan?

18. It's raining cats and dogs

19. Sa kasal, ang dalawang taong nagmamahalan ay nagbibigay ng kanilang matapat na pangako sa isa't isa.

20. Hindi po ba banda roon ang simbahan?

21. The dancers are not rehearsing for their performance tonight.

22. Ang daming tao sa divisoria!

23. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

24. No hay mal que por bien no venga.

25. Nagalit ang matanda at pinalayas ang babaeng madungis.

26. La salsa de habanero es muy picante, asegúrate de no agregar demasiado.

27. Hindi lang nila naririnig kundi nakikita pa ang katuwaan ng lahat.

28. Ang mga kasapi ng aming angkan ay nagkakaisa sa pagtatrabaho para sa kinabukasan ng pamilya.

29. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

30. Pada umumnya, keluarga dan kerabat dekat akan berkumpul untuk merayakan kelahiran bayi.

31. Matagal na kitang nakikitang namumulot ng mga kahoy sa gubat na ito.

32. If you're hoping to get promoted without working hard, you're barking up the wrong tree.

33. Les banques jouent un rôle clé dans la gestion de l'argent.

34. Ang mga puno ng kape ay nagbibigay ng mabangong amoy sa buong paligid.

35. The Lakers continue to be a dominant force in the NBA, with a dedicated fan base and a commitment to excellence on and off the court.

36. Hinihiling ko lang sana na sa aking pagpanaw ay kunin mo ang aking puso, sunugin mo, at ilagay sa banga ang abo nito.

37. Gusto ko na mag swimming!

38. Uncertainty can create opportunities for growth and development.

39. Mahilig kang magbasa? Kung gayon, baka magustuhan mo ang bagong librong ito.

40. Nakuha ko ang first place sa aking competition kaya masayang-masaya ako ngayon.

41. Ang pagpapahalaga sa mga kabuluhan ng buhay ay mas mahalaga kaysa sa mga kababawan ng mundo.

42. Al que madruga, Dios lo ayuda.

43. Alam ko.. sinabi niya sa akin yun..

44. Nakukulili na ang kanyang tainga.

45. Palibhasa ay magaling sa paglutas ng mga problema dahil sa kanyang mga analytical skills.

46. Ang maniwala sa sabi-sabi, walang bait sa sarili.

47. Scissors are commonly used for cutting paper, fabric, and other materials.

48. O sige, humiwa sya sa karne, pumikit ka.

49. Nagsayaw sa entablado ang mga mag-aaral nang limahan.

50. Chris Paul is a skilled playmaker and has consistently been one of the best point guards in the league.

Similar Words

created

Recent Searches

tiyacreatemobilearmedsweetusuariopageantpaamasdantonpangulotangansuhestiyonhumansignificantpagbabantanalagpasanskabelangkaygupittagalabamarasigantumulongrolandmalasmarietinahakmatandahinihilingsinakoppisogrupoumuwivillagelumakingumiwipinakamahabaiikutanarturonagtutulunganmaglabapagpilimatapobrenginvestingressourcernesong-writingmakapaibabawnalulungkotnagtatakbobarung-barongbridepagtataasatensyongnaiyakhampaslupanakasakaypamumunoengkantadanglumibotmakakabalikkabutihanmontrealuugod-ugodsharmaineitobarkocomoespecializadaskulturnaglokohanbakanteintindihinlabinggabethenjackzexperiencesbarrerassiyudadpwedenginhaledispositivosinilingwarinaawakoreapagiisipitinaobligaliglilikogusalinakapikitmag-amapaldareviewmaatimnochesilyamarangyangsumisidtsssmasinopkikofamepasensyabuenalalakingknightcallernagbungasellcongressbotantemagulang00ambringingoffentligmarkednaroonbreakmamuhayerrors,learninginsteadpatrickshiftibinibigayballre-reviewspendinginalalayankumaripasipinikitinterpretingsensiblekartonsutiliosdiyosinimbitakumalmasomelectlibroimpitbathalatipdiyanmalimitnahuhumalingpangalaniguhitmatalinokasalukuyanipatuloyhiraminyonaririnigtiningnanbirthdaylovepropesorbumilikahapongutomsantiyakincluirpilipinasinismabutingkaarawanlasadiliginanayniyantiktok,nangahasnapagtantohawlapanggatongperokare-karemalampasanbuwalsasakaymalilimutanpangungutyanagsunuranaddressmamataantataasnalamannag-ugatmarurumidaraanantuwangiphonejeromenapakahanga