Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "create"

1. Accomplishing a long-term goal can create a sense of euphoria and relief.

2. AI algorithms can be used to create personalized experiences for users, such as personalized recommendations on e-commerce websites.

3. As the eggs cook, they are gently folded and flipped to create a folded or rolled shape.

4. Climbing to the top of a mountain can create a sense of euphoria and achievement.

5. Completing a difficult puzzle or solving a complex problem can create a sense of euphoria.

6. Confocal microscopes use laser technology to create 3D images of small structures.

7. Dedication to a cause can mobilize communities, create social change, and make a difference in the world.

8. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

9. Emphasis can also be used to create a sense of urgency or importance.

10. Emphasis can be used to create a memorable and impactful message.

11. Emphasis can be used to create a sense of drama or suspense.

12. Emphasis can be used to create rhythm and cadence in language.

13. Facebook Events feature allows users to create, share, and RSVP to events.

14. Facebook Pages allow businesses, public figures, and organizations to create a public presence and interact with their audience.

15. Facebook provides tools for businesses to create and manage advertisements, track analytics, and engage with their target audience.

16. Green Lantern wields a power ring that allows him to create energy constructs based on his imagination.

17. His invention was an improvement over earlier attempts to create a long-distance communication device, such as the telegraph, which could only transmit messages in Morse code

18. I've found that sharing a personal story is a great way to break the ice and create a connection with others.

19. It can be helpful to create an outline or a mind map to organize your thoughts

20. It can create a sense of urgency to conceive and can lead to conversations and decision-making around fertility, adoption, or other means of becoming parents.

21. Many workplaces prioritize diversity, equity, and inclusion to create a more welcoming and supportive environment for all employees.

22. Receiving good news can create a sense of euphoria that can last for hours.

23. Receiving recognition for hard work can create a sense of euphoria and pride.

24. Seeing a favorite band perform live can create a sense of euphoria and excitement.

25. Seeing a long-lost friend or family member can create a sense of euphoria and happiness.

26. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

27. Supporting policies that promote environmental protection can help create a more sustainable future.

28. Sweetness can be balanced with other flavors to create a harmonious taste experience.

29. Sweetness can be used to mask other flavors and create a more palatable taste.

30. Taking a vacation to a beautiful location can create a sense of euphoria and relaxation.

31. Taking part in an activity that you are passionate about can create a sense of euphoria and fulfillment.

32. The TikTok generation is reshaping the way we consume and create content, with short-form videos becoming the new norm.

33. TikTok is a social media platform that allows users to create and share short-form videos.

34. Uncertainty can create opportunities for growth and development.

35. Users can create an account on Instagram and customize their profile with a profile picture, bio, and other details.

36. Users can create and customize their profile on Twitter, including a profile picture and bio.

37. Users can create profiles, connect with friends, and share content such as photos, videos, and status updates on Facebook.

38. While baby fever can be a powerful and overwhelming experience, it is a natural part of the human desire to create and nurture life.

39. Winning a lottery or a big prize can create a sense of euphoria and disbelief.

Random Sentences

1. Inaalam pa ng mga imbestigador ang tunay na motibo ng salarin sa krimeng nagawa niya.

2. Nakatayo ito sa kanyang tabi at hawak na naman ang kanyang kuwaderno at lapis.

3. Gusto ni Itay ang maaliwalas na umaga habang umiinom ng kape.

4. Ang talambuhay ni Leandro Locsin ay nagpapakita ng kanyang husay at kontribusyon sa arkitektura ng Pilipinas.

5. Tanging edukasyon lamang ang pag-asa nating mahihirap.

6. Napakalakas ng bagyong tumama sa kanilang bayan.

7. Inalagaan ng mag-asawa ang halaman at nang lumaki ay nagkabunga.

8. Sa kanilang panaghoy, ipinakita nila ang tapang sa kabila ng matinding pagsubok.

9. Sa kaibuturan ng aking damdamin, mahal ko siya.

10. Chumochos ka! Iba na pag inlove nageenglish na!

11. May I know your name for our records?

12. Ang pakikinig sa malumanay na himig ng mga instrumento ay nagpapalapit sa akin sa isang matiwasay na mundo.

13. Nasarapan ako sa luto ni Chef Josh.

14. Maligo kana para maka-alis na tayo.

15. Wala akong maisip, ikaw na magisip ng topic!

16. Scientific evidence suggests that global temperatures are rising due to human activity.

17. Les personnes âgées peuvent être en bonne santé ou avoir des problèmes de santé.

18. Las hojas de papel se pueden reciclar para hacer papel nuevo.

19. Malaki ang kama sa kuwarto ni Olivia.

20. Emphasis is the act of placing greater importance or focus on something.

21. Binili niya ang bulaklak diyan.

22. Smoking is a leading cause of preventable death worldwide.

23. Isa ang edukasyon sa pinakamahalagang bagay na hindi mananakaw ninuman.

24. Mathematical formulas and equations are used to express relationships and patterns.

25. All these years, I have been striving to live a life of purpose and meaning.

26. Sana ay makapasa ako sa board exam.

27. Dahil sa matinding ulan, nasira ang aming picnic at ikinakalungkot namin ito.

28. Napansin ko ang bagong sapatos ni Maria.

29. Naging malilimutin si Carla mula nang magkasakit siya.

30. El Día de San Valentín es una festividad muy popular en muchos países.

31. Es importante tener en cuenta la privacidad y la seguridad al utilizar las redes sociales.

32. Ang mga kundiman ay nagpapahayag ng pighati at lungkot ng mga taong nagmamahalan.

33. At sa kanyang paglayas, naligaw siya sa gubat at inatake ng maraming alamid.

34. Ang pagbabago ng pananaw at pag-iisip ay maaaring magdulot ng pagbabago sa pangamba.

35. Magtaka ka na kung hindi pa sya umuuwi bukas.

36. Ano ang malapit sa eskuwelahan?

37. Bilang paglilinaw, hindi ako nagsabi na aalis ako, kundi lilipat lang ako ng departamento.

38. Awitan mo ang bata para makatulog siya.

39. Limitations can be addressed through education, advocacy, and policy changes.

40. Tumayo ako para tingnan yung itsura ko ngayon.

41. They have been studying science for months.

42. Bakit anong nangyari nung wala kami?

43. Gumawa ako ng cake para kay Kit.

44. Dalam menghadapi tantangan, penting untuk memiliki dukungan sosial dan lingkungan yang positif.

45. Tengo una labradora negra llamada Luna que es muy juguetona.

46. Kantahan mo si Noel ng Kumanta ka ng kundiman

47. Environmental protection can also have economic benefits, such as creating jobs in sustainable industries.

48. El expresionismo es un estilo de pintura que busca transmitir emociones intensas.

49. Sa panghihiyang ginawa ni Kablan, gumanti ang pobreng matanda.

50. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Similar Words

created

Recent Searches

allowseditexplaincreatenagibangmakasakayicepalayannagpabayadkablanbrasomatatandawasakthingsisa-isaonlinekidkirancaraballoinjuryhotdogmuligtnapanoodpalantandaansubject,undeniablee-explainsundhedspleje,tsinapanitikannagbagopagkakataongkapatidsinasadyasimonmakidalomagkasamasalaminverypinagkaloobanactualidadramonipinadalananlakialsosumingittapusinmbalotatawaganvidenskablarongmaipantawid-gutomsigawdiyospakiramdamfloorkahoynalalabikomedorcupidbeastdyippunsonagkwentodividedpoliticsreadhagdanwonderdali-dalibwisitbatok---kaylamigkinakabahanamendmentngipingnakabaonkaloobangpigingnasasigningsninumanpopcornpagkapinagbigyanlagnatjailhouseipapaputolcreatedadditionallymalumbaynaturschoolscynthiasang-ayonmagpasalamatcompostganidabigaelmaaringupuanboboyou,executivenglalabaamericagirlbangkojackyahhpinagwagihangpagkakilalamaaloglumilipadmagpa-checkupprimerasthroathuhmagdidiskomindanaonagbakasyonnabalotdinaananbusinessespaulit-ulitnangahasnananaginipumuuwilumakingpassionmalampasaninternalinuulammelissapilipinasamapulgadaano-anoandreweddinghinaboltiyakmanghuliilalimnaantigtinulak-tulaktandahastaclientesartistasumasakayminutemetodiskiikotgulanglatesthumanapmundodulosumama1973outlinesbagsinehanpinakalutangfianceputolpuwedekastilapinaladnareklamopiyanonakasunodnanakawandangerousnatatawanginakadaratinglandonalulungkotmagkahawakgurotradisyoninabotroseatinkasamaanikinagagalakpasasaanbayaninararamdamanseasonbenefitsbagamatlunassampungmadadalaattacknaglulusakdescargarreorganizingniyog