Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "create"

1. Accomplishing a long-term goal can create a sense of euphoria and relief.

2. AI algorithms can be used to create personalized experiences for users, such as personalized recommendations on e-commerce websites.

3. As the eggs cook, they are gently folded and flipped to create a folded or rolled shape.

4. Climbing to the top of a mountain can create a sense of euphoria and achievement.

5. Completing a difficult puzzle or solving a complex problem can create a sense of euphoria.

6. Confocal microscopes use laser technology to create 3D images of small structures.

7. Dedication to a cause can mobilize communities, create social change, and make a difference in the world.

8. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

9. Emphasis can also be used to create a sense of urgency or importance.

10. Emphasis can be used to create a memorable and impactful message.

11. Emphasis can be used to create a sense of drama or suspense.

12. Emphasis can be used to create rhythm and cadence in language.

13. Facebook Events feature allows users to create, share, and RSVP to events.

14. Facebook Pages allow businesses, public figures, and organizations to create a public presence and interact with their audience.

15. Facebook provides tools for businesses to create and manage advertisements, track analytics, and engage with their target audience.

16. Green Lantern wields a power ring that allows him to create energy constructs based on his imagination.

17. His invention was an improvement over earlier attempts to create a long-distance communication device, such as the telegraph, which could only transmit messages in Morse code

18. I've found that sharing a personal story is a great way to break the ice and create a connection with others.

19. It can be helpful to create an outline or a mind map to organize your thoughts

20. It can create a sense of urgency to conceive and can lead to conversations and decision-making around fertility, adoption, or other means of becoming parents.

21. Many workplaces prioritize diversity, equity, and inclusion to create a more welcoming and supportive environment for all employees.

22. Receiving good news can create a sense of euphoria that can last for hours.

23. Receiving recognition for hard work can create a sense of euphoria and pride.

24. Seeing a favorite band perform live can create a sense of euphoria and excitement.

25. Seeing a long-lost friend or family member can create a sense of euphoria and happiness.

26. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

27. Supporting policies that promote environmental protection can help create a more sustainable future.

28. Sweetness can be balanced with other flavors to create a harmonious taste experience.

29. Sweetness can be used to mask other flavors and create a more palatable taste.

30. Taking a vacation to a beautiful location can create a sense of euphoria and relaxation.

31. Taking part in an activity that you are passionate about can create a sense of euphoria and fulfillment.

32. The TikTok generation is reshaping the way we consume and create content, with short-form videos becoming the new norm.

33. TikTok is a social media platform that allows users to create and share short-form videos.

34. Uncertainty can create opportunities for growth and development.

35. Users can create an account on Instagram and customize their profile with a profile picture, bio, and other details.

36. Users can create and customize their profile on Twitter, including a profile picture and bio.

37. Users can create profiles, connect with friends, and share content such as photos, videos, and status updates on Facebook.

38. While baby fever can be a powerful and overwhelming experience, it is a natural part of the human desire to create and nurture life.

39. Winning a lottery or a big prize can create a sense of euphoria and disbelief.

Random Sentences

1. Time heals all wounds.

2. Bigla nya akong hinigit sa kwelyo, Anong sinabi mo?

3. Nakaka-in love ang kagandahan niya.

4. Alam ko.. sinabi niya sa akin yun..

5. Nasa Canada si Trina sa Mayo.

6. Bukas na pala ang araw ng kalayaan.

7. Naglalakad siya sa parke araw-araw.

8. Ngunit walang maibigay ang mga tao sapagkat salat din sila sa pagkain.

9. Sa mga bundok, ang mga mountaineer ay nagtatanim ng puno upang mabawasan ang pagkaagnas ng lupa.

10. Ang masasakit na salitang binitiwan nya ay lubos na nakasakit sa kanyang ina.

11. The fashion designer showcased a series of collections, each with its own unique theme and style.

12. La tos puede ser un síntoma de COVID-19.

13. Working can provide a sense of purpose, achievement, and fulfillment.

14. Pagkatapos maligo, ang katawan ay nagiging mabango at malinis sa amoy.

15. May bakante ho sa ikawalong palapag.

16. Humihingal at nakangangang napapikit siya.

17.

18. Leonardo DiCaprio received critical acclaim for his performances in movies like "Titanic" and "The Revenant," for which he won an Oscar.

19. Sa kasalukuyan, marami ang may agam-agam sa kalagayan ng ating bansa sa gitna ng pandemya.

20. Sa bawat salita ng kundiman, nararamdaman ang pait ng paghihintay at pangungulila.

21. He starred in a number of films in the 1950s and 1960s, including Love Me Tender, Jailhouse Rock and Viva Las Vegas

22. Lagi nating isipin na ang mga pagsubok sa buhay ay hindi dapat maging hadlang upang maipagpatuloy ang ating buhay.

23. Los colores cálidos, como el rojo y el amarillo, transmiten energía en una pintura.

24. Ang apoy sa kalan ay nagbabaga pa rin kahit patay na ang apoy.

25. Bago pa man maghatinggabi ay dumating nga ang prinsipe at lubos na nalugod ang nag-aalalang prinsesa.

26. She is not designing a new website this week.

27. Masakit mang tanggapin, sa pamilya pa rin ang tatak ng iyong pagkatao.

28. Umokay ang result ng pagsusulit ni Jayson matapos itong magsunog ng kilay.

29. Los Angeles is home to prestigious universities like UCLA and USC, attracting students from around the world.

30. The king's role is to represent his country and people, and to provide leadership and guidance.

31. Frustration can be a normal part of the learning process and can lead to personal growth and development.

32. Nagtatanim kami ng mga halamang gamot para sa aming natural na gamutan.

33. Landbrugsprodukter, især mejeriprodukter, er nogle af de mest eksporterede varer fra Danmark.

34. Napupuno ako ng poot sa tuwing naaalala ko ang mga pagkakataon na ako'y pinagtaksilan at sinaktan.

35. Ang kaibuturan ng kanyang pagkatao ay hindi mo agad makikita.

36. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

37. Di kalaunan, habang lumalaki ang bata, napapansin nilang ito nagiging salbahe, napakasinungaling at maramot.

38. Ang pagpili ng mga kasuotan para sa kasal ay dapat ayon sa tema ng kasal.

39. Hay muchos géneros de música, como el rock, el pop, el jazz y el clásico.

40. Después del nacimiento, el bebé puede ser amamantado o alimentado con fórmula, dependiendo de las preferencias de los padres y la salud del bebé.

41. They have adopted a dog.

42. Ang labi niya ay isang dipang kapal.

43. Lumabas na rin naman ako pagkatapos.

44. Ang pagtugtog ng malamig na musika ay nakatulong sa akin na magrelaks at magkaroon ng matiwasay na isip.

45. Ang bayan na matatagpuan sa lugar ng mga bundok, ay hindi matatag sa pagkakataong darating ang unos.

46. Waring malungkot siya ngayon, ngunit hindi niya sinasabi kung bakit.

47. Nakahiga ako sa gabi nang biglang magkaroon ng malakas na kidlat at nagitla ako sa takot.

48. Ang bayang magiliw, perlas ng silanganan.

49. Ilang termino na syang nagsisilbi bilang mayor ng kanilang lungsod.

50. Sorry.. pati ikaw nadadamay. E-explain ko na lang sa kanya..

Similar Words

created

Recent Searches

createkinatatayuanmemorybituinsourceclassesmuntikanlalakinakakabangontinulak-tulakpresidentialdatapwatmaintindihannaglaronagbanggaannapakamisteryosokinamumuhianhumakbangkananiloilokaloobangnagkasunognaiisiphouseholdumiimiknami-misscountrynagbentanahantadinstitucionesiyongsalbaheomfattendehimayindragonnogensindewikatusindvistignanstoapoyayokodiscoveredsinumangtumangosinimulanokaymangingisdapamanblazingtapatjoemerryproductionkwebayeptinanggapparaisopartycallnaroonnamanprocessworkdaybeyondnutsmagkikitabaku-bakongenfermedades,nagmadalingvisualspiritualsalu-salonakabulagtangpoliticalpinagsikapanikinabubuhaypakikipagtagpogayundinkinapanayamnagpaiyakkinagalitansalamangkerohinipan-hipannanghihinapagpasensyahannagmakaawadumagundongmakidalomahawaancultivaagam-agampaglalaitsalenakapagsabinakatirangnagpatuloykahuluganmatagpuanpandidirimaisusuotpumitaspagkainistitainaaminpanalangintumatawaginspireddurianmalakaspinuntahanmagkamalimedisinaphilanthropydoble-karanaguguluhanpaglakinagliwanagpagpilinapakamotmusicalesmaibibigaybalahiboincluirlumabasnangapatdanpaglalabamagdamaganmagkasamamedicalwatawatngitinatinaglumipadjosiekahoyminatamishahahacompaniessuzettenanonoodkinakainfranciscopagpapakainkalabanmahiwagangnilaosjeepneytumingalalolabusiness:nakarinigafternoongarbansoskapatagansugatangfallmakapangyarihanbinawianmahigitkaraokesahodtusongpagiisippagmasdannaghubadniyondisensyopulitiko1960sagostogownbumangontamadquarantinekutsilyonakabiladpayonglittleumakyatpagkatnaisnegosyobagkusestilosimbesipinamilismilekunwacareerstonehampaksalenguajeginaganoonsigloayawmatabangtamaiskedyultambayan