Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

12 sentences found for "throughout"

1. Basketball requires a lot of physical exertion, with players running, jumping, and moving quickly throughout the game.

2. Eating small, healthy meals regularly throughout the day can help maintain stable energy levels.

3. Einstein was a pacifist and spoke out against war and violence throughout his life.

4. Einstein was also an accomplished musician and played the violin throughout his life.

5. Kings have held power throughout human history, from ancient civilizations to modern times.

6. Known for its sunny weather, Los Angeles enjoys a Mediterranean climate throughout the year.

7. Overall, coffee is a beloved beverage that has played an important role in many people's lives throughout history.

8. The belief in God is widespread throughout human history and has been expressed in various religious traditions.

9. The city hosts numerous cultural festivals and events, celebrating different traditions and communities throughout the year.

10. Throughout history, technology has played a vital role in shaping human civilization and has had a profound impact on society

11. Throughout the years, the Lakers have had fierce rivalries with teams such as the Boston Celtics and the Los Angeles Clippers.

12. Women have made significant contributions throughout history in various fields, including science, politics, and the arts.

Random Sentences

1. Mula sa malayo, anong gulat nila Magda nang makitang nagtalunan sa ilog sina Maria at Jose upang humabol.

2. Ang hindi magmahal sa sariling wika, ay higit pa sa hayop at malansang isda.

3. Diversification is a strategy that involves spreading investments across multiple asset classes to reduce risk.

4. Pinanood ng bata ang babae habang ito ay kumakain.

5. Gaano karami ang dala mong mangga?

6. It's frustrating when people beat around the bush because it wastes time and creates confusion.

7. Reden ist Silber, Schweigen ist Gold.

8. Sa isang linggo ay pupunta kami sa Singapore.

9. En invierno, el cielo puede verse más claro y brillante debido a la menor cantidad de polvo y humedad en el aire.

10. Mga bopols! Tape lang hindi nyo pa nagawang makabili!

11. Nang marinig ang tawag ng nanay niya, kumaripas ng uwi ang batang naglalaro sa labas.

12. Naghihinagpis ang ina sa pagkamatay ng kanyang anak na nauwi sa isang aksidente.

13. Some people invest in cryptocurrency as a speculative asset.

14. Pariwisata religi menjadi daya tarik bagi wisatawan lokal dan mancanegara yang tertarik untuk mengunjungi tempat-tempat suci dan melihat praktik keagamaan yang unik di Indonesia.

15. Omelettes can be seasoned with salt, pepper, and other spices according to taste.

16. People can also borrow money through loans, credit cards, and other forms of debt.

17. Magsasalita na sana ako ng sumingit si Maico.

18. "May sorpresa ako para sa’yo," ani ng tatay sa kanyang anak.

19. Pinagalitan niya ang matanda at tinulak-tulak ito.

20. Ang talambuhay ni Andres Bonifacio ay nagpapakita ng kanyang matatag na pagtitiis sa gitna ng mga pagsubok.

21. In the early days, telephones were connected to a central switchboard, which connected calls manually

22.

23. Pneumonia is a serious infection that affects the lungs.

24. I usually stick to a healthy diet, but once in a blue moon, I'll indulge in some ice cream or chocolate.

25. Natawa kami sa inasta ni Sara dahil para siyang bata.

26. Different types of stocks exist, including common stock, preferred stock, and penny stocks.

27. Naglakad ang mga sundalo sa kalsada nang limahan.

28. Algunas plantas son comestibles y se utilizan en la alimentación, como las frutas y verduras.

29. The team's success and popularity have made the Lakers one of the most valuable sports franchises in the world.

30. Maiba ako Ikaw, saan ka magpa-Pasko?

31. The cake was a hit at the party, and everyone asked for the recipe.

32. Ang mabuti ho yata, e dalhin na natin iyan kung dadalhin.

33. She opted for a lightweight jacket to wear during her morning run.

34. Ang pag-asa ay nagbibigay ng mga oportunidad sa mga tao upang magpakatotoo at magpakabuti.

35. ¿Dónde está el baño?

36. Twitter allows users to send direct messages (DMs) to each other for private conversations.

37. Asegúrate de que el área esté libre de maleza y que el suelo sea bien drenado

38. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

39. She wakes up early every morning to exercise because she believes the early bird gets the worm.

40. Kumikinig ang kanyang ulo at nangangalit ang kanyang ngipin.

41. Sadyang maganda ang panahon ngayon kaya't magpi-picnic kami sa park.

42. Hindi ko alam kung bakit ang ibang tao ay madalas na mangiyak-ngiyak sa kahit anong bagay.

43. Hindi ko mapigilan ang aking mga titig sa aking nililigawan dahil sobrang ganda niya.

44. How I wonder what you are.

45. Ang tindahan ay nasara dahil sa paulit-ulit na pag-suway sa business regulations.

46. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

47. The store has a variety of sizes available, from small to extra-large.

48. Napabayaan na nga ang diyosa ng mga tao at hindi na nag-aalay ng bulaklak sa kaniya.

49. Dalam menghadapi tantangan, penting untuk memiliki dukungan sosial dan lingkungan yang positif.

50. Users can create an account on Instagram and customize their profile with a profile picture, bio, and other details.

Recent Searches

throughoutnagre-reviewmagpapabunotpag-aralinpublishingtambayancoinbasediretsolutuingabrielmakapilinghaterevolutionizedcompletespreadyearkumanankuwartoenglandhanapinkinikitatahimikinaabutanmatangkadbedsidemalamangipinagbabawalkaysanagtinginangotkinakabahaninteligentesprocesotiniklingreguleringagoswednesdaytumibaykangkongnagmadalitindahanhundred11pmsobracorrectingmasinopyorkteknologitelephonetilanapatakbopuedenag-aabangpalabuy-laboybienbabahopemayapatihalalanleoiniirogtotoongoperahanactivitynapuyatyungsinabitamisbuenanewnakakalayoalongbeintecessilid-aralanoktubrenapakamisteryososimpelyelopinagkaloobanhumakbangkatedralrobinhoodpumitasbigkispadaboggreatmagingsaturdaynandunbumiliseditorsakupinplanikinamataysinokokakshareitemsthereforesolarmakahiramsulyapnapakabagalkasinglumingonjosephissuesuwakheipundidotanyagmagasawangkasamaanhapag-kainanpagsumamolegendsayanakalaingboksingmatandang-matandasalesbornhoyt-shirtestatemismohimigmaagangsportsmagbalikbosesumuwistreetmatabaheartconstantlymatatalokulaybumilicrucialilangbuwalwalang-tiyakgympulangmaaaribroadcastlabasluisnapag-alamannakakaalammayobignagigingsponsorships,nadamabuspinagburolopportunitiesfallgawamuntingnasasakupanseparationphysicalmasayaangkopkungtumunogpagbabayadbakitpebreromabutigayunpamankatutuboinvestingactingsinusuklalyanpagpanhikdecreasedbaopagkaangatvidenskabenproporcionarbuhaybutasmagulayawpinanawanmidtermaustraliaantoniohappynilayuancynthianag-aalaydyiptono