Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

12 sentences found for "throughout"

1. Basketball requires a lot of physical exertion, with players running, jumping, and moving quickly throughout the game.

2. Eating small, healthy meals regularly throughout the day can help maintain stable energy levels.

3. Einstein was a pacifist and spoke out against war and violence throughout his life.

4. Einstein was also an accomplished musician and played the violin throughout his life.

5. Kings have held power throughout human history, from ancient civilizations to modern times.

6. Known for its sunny weather, Los Angeles enjoys a Mediterranean climate throughout the year.

7. Overall, coffee is a beloved beverage that has played an important role in many people's lives throughout history.

8. The belief in God is widespread throughout human history and has been expressed in various religious traditions.

9. The city hosts numerous cultural festivals and events, celebrating different traditions and communities throughout the year.

10. Throughout history, technology has played a vital role in shaping human civilization and has had a profound impact on society

11. Throughout the years, the Lakers have had fierce rivalries with teams such as the Boston Celtics and the Los Angeles Clippers.

12. Women have made significant contributions throughout history in various fields, including science, politics, and the arts.

Random Sentences

1. May problema ka sa oras? Kung gayon, subukan mong gumawa ng iskedyul.

2. Dalhan ninyo ng prutas si lola.

3. Nasa silid-tulugan ako at nagitla ako nang biglang bumukas ang bintana sa malakas na hangin.

4. Dahan dahan akong tumango.

5. Ang bayanihan ay nagpapakita ng diwa ng pagmamalasakit at pagbibigayan sa aming komunidad.

6.

7. Bilang panghabambuhay na parusa ay pinamalagi ng Adang manatili sa labas ng Kasoy ang abuhing Buto nito.

8. Ano?! Diet?! Pero tatlong plato na yan ah.

9. Gusto ko lumabas pero malakas pa ang ulan.

10. A couple of cars were parked outside the house.

11. Sa tuwing mag-iisa ako, naiisip ko ang aking mga kaulayaw na nasa aking tabi.

12. Itinago ko ang mga sulat para sa inyo.

13. Katamtaman ang pangangatawan ng nanay ko.

14. The authorities were determined to find the culprit responsible for the environmental damage.

15. Bruce Lee was a martial artist, actor, and philosopher who is widely considered to be one of the most influential figures in the history of martial arts

16. La alimentación equilibrada y una buena hidratación pueden favorecer la cicatrización de las heridas.

17. La realidad puede ser cambiante, debemos ser flexibles y adaptarnos.

18. Omelettes are a popular choice for those following a low-carb or high-protein diet.

19. Pumunta kami kahapon sa department store.

20. Berbagai lembaga dan organisasi keagamaan berperan aktif dalam memberikan pelayanan sosial, pendidikan, dan bantuan kemanusiaan bagi masyarakat Indonesia.

21. Albert Einstein was a theoretical physicist who is widely considered one of the most influential scientists of the 20th century.

22. Governments and financial institutions are exploring the use of blockchain and cryptocurrency for various applications.

23. Napakabango ng sampaguita.

24. El que espera, desespera.

25. The baby is not crying at the moment.

26. Bawat isa sa atin ay may malalim na koneksyon sa lahat ng ito, sapagkat ang panitikan ay bahagi ng kultura at buhay ng bawat isa sa atin.

27. The Discover feature on Instagram suggests accounts and content based on a user's interests and interactions.

28. Si Ogor ang kinikilalang hari sa gripo.

29. Sa bundok ng mga anito na ngayon ay kilala bilang bundok ng Caraballo itinindig ang krus.

30. Setiap tantangan membawa pelajaran berharga yang dapat digunakan untuk menghadapi tantangan berikutnya.

31. Hindi lang militar ang nakikinabang sa digmaan, maaari rin itong magbigay ng oportunidad sa mga negosyante.

32. Les enseignants doivent planifier leurs cours en fonction des objectifs d'apprentissage.

33. Sinabi ng guro na huwag magtapon ng basura palayo sa tamang basurahan.

34. This has led to increased trade and commerce, as well as greater mobility for individuals

35. The patient's quality of life was affected by the physical and emotional toll of leukemia and its treatment.

36. Ilang termino na syang nagsisilbi bilang mayor ng kanilang lungsod.

37. Limitations can be self-imposed or imposed by others.

38. Mas nagustuhan ko ang guro ko sa Musika kaysa sa dati kong guro.

39. Maaliwalas ang mukha ni Lola matapos siyang bisitahin.

40. Dialog antaragama dan kerja sama antarumat beragama menjadi penting dalam membangun perdamaian dan keharmonisan di tengah keragaman agama.

41. Di-kalayuan sa gripo ay may isang tindahan.

42. Los árboles pueden perder sus hojas en invierno, creando un aspecto desnudo y frío.

43. Ketika dihadapkan pada tantangan, penting untuk memiliki sikap positif dan optimis.

44. Lumapit siya sa akin tapos nag smile. Nag bow ako sa kanya.

45. They have donated to charity.

46. Regular exercise and playtime are important for a dog's physical and mental well-being.

47. The introduction of the dial telephone in the 1920s further improved the telephone system, as it allowed for faster and more efficient call connections

48. Humigit-kumulang sa tatlong daan taong namalagi sa Pilipinas ang mga Kastila.

49. Women's relationships with their bodies have been shaped by societal expectations and cultural norms.

50. Waring hindi siya sang-ayon sa desisyon ng grupo, ngunit hindi niya ito ipinakita.

Recent Searches

throughoutginisingshapinginalokprogramamaratinguniquevisualnevermichaelupworktaletilaviewsbroadmind:chartsmuntingakalaiiwannag-oorasyonpostdisensyotonotumabapinag-usapanrubberlibrarymajordagatbahaymagsasalitaspaghettitumingalatumindigtresnagbibigaykapamilyabulaklaknahigapaghuhugasonlinesweetresignationabuhingpangulolalakingprimerosactualidadrollnaka-smirkgawaayudastocosechabudokkasamaansundavaoanumanglandslidemakakatakasbayaannapansinnanginginigumuusigboardreynana-fundsiglaregularmenteumakyatpunung-kahoypinakamahalagangmedya-agwanagbanggaankamakailannagsisigawmagagandangpaglalabadaiintayinkaharianpapagalitannakakabangonmatayogmagbayadromeroanonaglahonangahasnasiyahannapagtantomakuhangcancermaipagmamalakingnagpabotmakapagempakeintensidadkatutubodyipniasignaturangumingisivideospagkaangattotoongpumulotnapilidropshipping,nai-dialmadungistinungocountrybowledukasyonbayanniyogmakisuyosunud-sunodinaabotbinentahannagdalaiikutansagabalproducerergasmenbihasaisubonaglulusakgatolnauntogninyongnatitirangnabigaynayonganyantatlopagkaingkamalayanshadesinstitucionesumigibkainanitinulosexpresantusindvisimbespelikulagreatlysalbahemaayosbultu-bultongbumuhosangelasilaairconhvertignanapoybinatangsinimulanhiningikombinationbecamesagaprosellegenerositymahahabapulubimorenablazingeffektivlamansoccersinksigaleyteparacontent,kerbhearmedievalartsbataysinapakindividualcarstoolcdnaiinggitcoachingactingaddressipinagbilingbarriersdaancasesmereumilinglimitprovided