Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

4 sentences found for "mission"

1. Bukas ay pupunta kami sa isang medical mission.

2. Naging bahagi siya ng agaw-buhay na rescue mission upang iligtas ang mga tao sa panganib.

3. The mission was labeled as risky, but the team decided to proceed.

4. Tom Cruise is a highly successful actor known for his roles in movies like "Top Gun" and the "Mission: Impossible" series.

Random Sentences

1. Fleksibilitetstræning, såsom yoga og strækning, kan hjælpe med at forbedre bevægeligheden og reducere risikoen for skader.

2. Hindi ko matiis ang pagkaantabay sa kanyang mga mensahe dahil gustung-gusto ko siyang kausapin.

3. Walang kagatol gatol na nagsalita ang lalake laban sa kanyang amo.

4. Talaga? aniya. Tumango ako. Yehey! The best ka talaga!

5. The journalist interviewed a series of experts for her investigative report.

6. Hendes hår er som silke. (Her hair is like silk.)

7. Hindi ko pa nababasa ang email mo.

8. Nanalo si Lito sa pagka gobernador ng kanilang lugar.

9. Marahan niyang inalis sa pagkakakawit ang mga balde.

10. Agama adalah salah satu aspek penting dalam kehidupan banyak orang di Indonesia.

11. Ang pusa ay naglaro ng bola ng sinulid buong maghapon.

12. Es importante reconocer los derechos y la dignidad de todas las personas, incluidas las personas pobres.

13. Naisip niya na mas maganda kung nag-iisa siya sa bukid.

14. Users can follow other accounts to see their tweets in their timeline.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. Many schools and universities now use television as a way to provide distance learning

17. No hay mal que por bien no venga.

18. Tumigil muna kami sa harap ng tarangkahan bago pumasok sa simbahan.

19. Bumili si Ryan ng pantalon sa palengke.

20. Successful entrepreneurs attribute their achievements to hard work, passion, and unwavering dedication.

21. Papunta siya sa Davao bukas ng tanghali.

22. May himig pangungutya ang tinig ng pulis.

23. Sa mula't mula pa'y itinuring na siya nitong kaaway.

24. Superman possesses incredible strength and the ability to fly.

25. Talaga ba Sharmaine?

26. This can include correcting grammar and spelling errors, reorganizing sections, and adding or deleting information

27. Twitter has millions of active users worldwide, making it a powerful tool for real-time news, information, and social networking.

28. Samantala sa pagtutok sa kanyang mga pangarap, hindi siya nagpapatinag sa mga hamon ng buhay.

29. Kahit ang diyosang si Venus ay walang panama sa kaniya.

30. Sumimangot ako at humarap ulit sa labas.

31. Landet er en af de mest velstående i verden, og dette kan tilskrives en række faktorer, herunder en høj grad af økonomisk vækst, en velfungerende arbejdsstyrke og en høj grad af offentlig velfærd

32. Sana hinde na lang ako nagloko. Sana naniwala na lang ako.

33. Electric cars can help reduce air pollution in urban areas, which can have positive impacts on public health.

34. Fødslen kan også være en tid til at forbinde med ens partner og skabe en dybere forståelse og respekt for hinanden.

35. Beauty. maya-maya eh sabi ni Maico.

36. Il faut que j'aille faire des courses ce soir.

37. Umaasa si Carlos Yulo na mas maraming kabataan ang mahihikayat na pasukin ang larangan ng gymnastics.

38. Biglang bumangon ang hari at hinugot ang espada.

39. The photographer captured the essence of the pretty lady in his portrait.

40. Pasensya na, kailangan ko umalis ng maaga.

41. They are attending a meeting.

42. Tweets are limited to 280 characters, promoting concise and direct communication.

43. Los sueños pueden ser grandes o pequeños, lo importante es tenerlos y trabajar para hacerlos realidad. (Dreams can be big or small, what's important is to have them and work towards making them a reality.)

44. ¿Qué le puedo regalar a mi novia en el Día de San Valentín?

45. Conservation efforts, such as protecting natural habitats and endangered species, are critical to maintaining a healthy environment.

46. The acquired assets were key to the company's diversification strategy.

47. La acuarela es una técnica de pintura que utiliza pigmentos mezclados con agua.

48. The discovery of cheating can lead to a range of emotions, including anger, sadness, and betrayal.

49. Kapag may isinuksok, may madudukot.

50. Nous avons eu une danse de mariage mémorable.

Similar Words

commission

Recent Searches

missionhoynagpagupitsumagotganoonexperiencesimagesparkingkalongadaptabilitynatandaanpatieuphoricleegagawinresearch:unowouldincreasesfistsputingbehaviorcontinueoktubrepagmamanehopaumanhinnanonoodrevolutionizedinteligentesgobernadortabing-dagathitsuramensajesbumuganearpagsisisicultureukol-kaytravelpooreraga-agahabitsisusuotmiyerkulesrolebanlagsementongpaaralanpabilitiemposniyanhabitbairdlandewidedagaadverselymillionskasingslaveknownamalagipagtinatawagkagandahagmatatalopinakamatapatpagtataposcultivarnagkakasyanasasakupandropshipping,businessesnaiilagannangangaraliniuwimagawasiguradoe-booksdondeisasamanabigkasdiferentesbihirangpagbatiandreanatutulogminerviesinaliksikuniversitiestelahinahaplosnatigilanumigibpelikulafrescoaksidenteasiaticlihimdangerousdaladalanagpuntakahilinganisipshowsmournedbukodmatapos1973mulighedtools,boktulongpagkamanghabisigoverviewstorebinabaanmapadalibeforebabaworkdaysafebinilingprocessrememberamountmagpa-ospitallastingkinagalitannagsisipag-uwianflyvemaskinernahintakutankapamilyamungkahimagsasakanagkasakitmagkanolumayotumamisbinabaratumokaynatitirangtarangkahankamalayanbinatilyomalilimutanhotelself-defensegreatlymatarayadvancecarmentuloyarguemedyobinasaarbejdertsesamakatwidbriefpasyaloobfloorbellperangcreatethereforetextomatabanakikini-kinitanagkakatipun-tiponpag-aalalamakapangyarihanagwadorkapasyahannakikiasalamangkeroimulatvitaminabstaining2001kulunganmasayangmahinoginuulcernaiiritangnatatawahahahapaalamkristosocialestechnologicaldealmbricoshawlabutodalawinpinoykabuhayan