Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

2 sentences found for "lipat"

1. Inalagaan niyang mabuti ang halaman at tinawag itong Pinang, Sa palipat-lipat sa bibig ng mga tao ang pinang ay naging pinya.

2. Walang ano-ano ay lumipad at nakita ni Perla ito na pumunta sa halamanan at nagpalipat lipat sa mga bulaklak.

Random Sentences

1. Los bosques son ecosistemas llenos de árboles y plantas que albergan una gran diversidad de vida.

2. Sa gitna ng tagtuyot, ang mga magsasaka ay nagiigib mula sa ilog para sa kanilang mga pananim.

3. Det giver os mulighed for at udføre mange forskellige opgaver, fra simpel redigering af tekst til avancerede beregninger og simuleringer

4. Many cultures have their own unique traditions and customs surrounding weddings.

5. Ang pagguhit ay isang paraan upang maipakita ang iyong talento.

6. Dahil ang alam lang ay kumain, hindi alam ni Ranay kung paano ma-buhay na siya ang kikilos at magta-trabaho.

7. Ang mga palaisipan ay maaaring nagbibigay ng mga oportunidad para sa paglutas ng mga problema at pagtugon sa mga hamon sa buhay.

8. Di na natuto.

9. He was hospitalized for pneumonia and was on a ventilator for several days.

10. Mayroong proyektor sa silid-aralan upang mas maipakita ang mga visual aids sa pagtuturo.

11. La pintura al óleo es una técnica clásica que utiliza pigmentos mezclados con aceite.

12. Pantai Tanjung Aan di Lombok adalah pantai yang terkenal dengan pasir putihnya yang halus dan air laut yang tenang.

13. Scientific experiments have shown that plants can respond to stimuli and communicate with each other.

14. Ella yung nakalagay na caller ID.

15. Magtanim tayo ng kabutihan sa lupa upang anihin natin sa langit.

16. Pahiram ng iyong payong, mukhang uulan na mamaya.

17. All these years, I have been striving to live a life of purpose and meaning.

18. Pagkatapos ng malagim na balita, natagpuan ko ang aking sarili na tulala sa kanyang kwarto.

19. Hindi ko alam kung paano mo ito tatanggap, pero may gusto ako sa iyo.

20. Riega el maíz regularmente y asegúrate de que el suelo esté siempre húmedo

21. The team’s momentum shifted after a key player scored a goal.

22. Nagpa-photocopy ng report si Kiko.

23. Wag ka nang malumbay dahil nandito naman ako.

24. Cancer can impact individuals of all ages, races, and genders.

25. Nais naming makita ang mga balyena sa malapit na karagatan.

26. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

27. Walang kagatol gatol na nagsalita ang lalake laban sa kanyang amo.

28. Disfruto explorar nuevas culturas durante mis vacaciones.

29. Sa tabi ng aming bahay, ako ay nagtatanim ng mga herbs at spices.

30. This was a time-consuming process, and it was not until the invention of the automatic switchboard in 1892 that the telephone system became more efficient

31. She has been tutoring students for years.

32. I got my sister a cake and wrote "happy birthday" in frosting on top.

33. Si Aling Pising naman ay nagpupunta sa bayan upang ipagbili ang mga nagawang uling.

34. Mahalagang magpakatotoo sa pagpapahayag ng financial status upang maiwasan ang pagkakaroon ng maraming utang.

35. Bunga ng globalisasyon ang pag-unlad ng maraming industriya sa iba't-ibang bansa.

36. Napapaisip ako kung ano pa ang mga magagandang paraan upang mapaligaya ang aking nililigawan.

37. El agua es utilizada en diversas actividades humanas, como la agricultura, la industria y el consumo doméstico.

38. Nagsagawa ang pulisya ng mga raids sa mga tahanan ng mga kilalang salarin sa lugar.

39. La inversión en la agricultura es importante para apoyar a los agricultores y la producción de alimentos.

40. AI algorithms can be used in a wide range of applications, from self-driving cars to virtual assistants.

41. Hindi ko kayang isipin na hindi kita kilalanin, kaya sana pwede ba kita makilala?

42. Los agricultores deben estar atentos a las fluctuaciones del mercado y la demanda de sus productos.

43. Oy oy! Tama na yan baka maaksidente tayo!

44. Malinis na bansa ang bansang Hapon.

45. Isa-isa niyang tiningnan ang mga nakapaligid sa kanya.

46. Las vacaciones de invierno son un momento para descansar y pasar tiempo en familia.

47. Pumunta ka dito para magkita tayo.

48. Después de la tormenta, el cielo se vuelve más oscuro y las nubes se alejan.

49. Paano tayo? Di mo pa sinasagot yung tanong ko. aniya.

50. La santé sexuelle est également un élément important de la santé globale d'une personne.

Similar Words

palipat-lipatnagpalipat

Recent Searches

lipatpapuntachangedlockdowngagahinagispaghamaktsakadied1982likeshitikdaantraditionalcomuneslumusobpamilyatuladoncenangangalitmahiyasamfundpaanannawalamasayahinnapakaramingcardigankitangscalelandbarrocowikamamayadogkapalnutrienteskaliwangpumayagsiyamparticularnagbibigaygitnabahay-bahayinuminintsikstorypagkakalutolumakadkaniyanakakakuhanewkidkiranitimdalirikahitdarnapumapasokkaguluhanneaanonglarawantanimnagkakakainmakisuyolokohinmulingitinulosmaisimpactiwinasiwasdalhannagandahanmatapangtomorrowgivelamanglibrengsinundonawawalatsssdasalnaabutansasakayininomnagtakapinuntahankayakinukuhahierbaspagkapitashistorytiyahalamanhanap-buhaypapelpaliparinmakisighayaanglibongdurasbatotrabahomahinahongespadanahigitanconventionalhinihilingmakalapitlegendpumupuntalumiwagekonomiyatransportmakaratingawitindivisionsuccessusoaraw-bilangfederalcontrolarlaskumainjuegossalapilupacedulamontrealsumibolpronounnag-away-awaydirectakristofysik,positibodiferentesmobilemedisinamabuhaypag-iyakmagnanakawkaloobanpusongnahihirapantinataluntonnaalismasyadongincreasesbigyanwalaumaagosctileskargahannathanpakisabiopportunitiespalantandaannamangkatolisismoginhawapahabolkahirapanpang-araw-arawmabalikconclusion,gasolinahansipagprogramabaku-bakongpaghahanguanunapagkapunosiniyasatnoodcantidadbroadcastpeppydilawina-absorvepakaininintroducesoresasayawinputolipagtanggolakalaingtawanannaidliptutungosinusuklalyanmerondalawakalakingmetrofollowingprotegidoilawpinag-aralantanawinhad