Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

13 sentences found for "interests,"

1. Effective representatives possess strong communication, leadership, and negotiation skills to effectively represent their constituents' interests.

2. Groups on Facebook provide spaces for people with shared interests to connect, discuss, and share content.

3. He pursued an "America First" agenda, advocating for trade protectionism and prioritizing domestic interests.

4. It's hard to break into a new social group if you don't share any common interests - birds of the same feather flock together, after all.

5. It's important to be realistic about your expectations and to choose a strategy that aligns with your skills and interests

6. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

7. The Discover feature on Instagram suggests accounts and content based on a user's interests and interactions.

8. The Explore page on Instagram showcases content from various categories such as fashion, food, travel, and more, catering to different interests and preferences.

9. The TikTok algorithm uses artificial intelligence to suggest videos to users based on their interests and behavior.

10. There are many ways to make money online, and the specific strategy you choose will depend on your skills, interests, and resources

11. They engage in debates and discussions to advocate for their constituents' interests and advance their agendas.

12. They play a crucial role in democratic systems, representing the interests and concerns of the people they serve.

13. Women have diverse interests and hobbies, from sports and fitness to travel and cooking.

Random Sentences

1. Ang aking ina ay isang magaling na mananahi.

2. Ang mga manggagawa at magsasaka ay kabilang sa sektor ng anak-pawis.

3. Marami siyang kaibigan dahil palangiti siya.

4. Ang bobo naman ito, di pa nasagutan ang tanong.

5. Frustration can also be caused by interpersonal conflicts or misunderstandings.

6. Sadyang mapagkumbaba siya kahit na siya ay mayaman.

7. Les maladies transmissibles peuvent se propager rapidement et nécessitent une surveillance constante.

8. Ang talambuhay ni Manuel L. Quezon ay nagpapakita ng kanyang pagmamahal sa bayan at liderato sa panahon ng kolonyalismo.

9. Sa pagguhit, puwede ka rin mag-experiment ng iba't-ibang kulay at matutunan ang mga color combinations.

10. Nagreport sa klase ang mga grupo nang limahan.

11. Taking a vacation to a beautiful location can create a sense of euphoria and relaxation.

12. Spil kan have regler og begrænsninger for at beskytte spillerne og forhindre snyd.

13. Dahil sa kagustuhang malaman ng mga kapatid ni Psyche ang hitsura ng asawa, tinanggal nila ang maskara nito at tumambad ang magandang mukha ni Cupid

14. Dapat nating igalang ang kalayaan ng bawat isa kahit na mayroong magkaibang paniniwala.

15. El powerbank se carga conectándolo a una fuente de energía, como un enchufe o una computadora.

16. We have been walking for hours.

17. Nagtayo ng scholarship fund si Carlos Yulo para sa mga batang gustong mag-aral ng gymnastics.

18. Sa pamamagitan ng pagkuha ng mahusay na tulog, ang aking pagkapagod ay napawi at nagkaroon ako ng sariwang enerhiya.

19. Ang tindahan ay nasara dahil sa paulit-ulit na pag-suway sa business regulations.

20. They go to the movie theater on weekends.

21. Wala akong maisip, ikaw na magisip ng topic!

22. The woman walking towards me was a beautiful lady with flowing blonde hair.

23. All these years, I have been overcoming challenges and obstacles to reach my goals.

24.

25. Omelettes are a popular choice for those following a low-carb or high-protein diet.

26. Nagbabala ito na may darating na lindol sa kapatagan at magbibitak-bitak daw ang lupa sa kapaligiran.

27. A couple of hours passed by as I got lost in a good book.

28. Bigla niyang naalala si Helena, napatigil siya sa kanyang pag-iyak at napangiti na lang ang binata.

29. Aplica abono orgánico al suelo para proporcionar nutrientes adicionales a las plantas

30. Nosotros decoramos el árbol de Navidad juntos como familia durante las vacaciones.

31. Instagram Stories is a feature that lets users share temporary photos and videos that disappear after 24 hours.

32. The President is also the commander-in-chief of the armed forces and has the power to veto or sign legislation

33. Sa tulong ng meditasyon, mas napalalim ang aking kamalayan sa aking sarili at emosyon.

34. Ang labi niya ay isang dipang kapal.

35. Gusto ko ang mga bahaging puno ng aksiyon.

36. Hinde naman ako galit eh.

37. Women have made significant strides in breaking through glass ceilings in various industries and professions.

38. Gaano katagal niyang hinintay ang pakete?

39. Ang bahay ni Lola ay palaging mabango dahil sa mga bulaklak na nasa hardin.

40. Maganda ang tanawin sa dagat tuwing takipsilim.

41. Sa araw araw na pagkikita ng dalawa ay nahulog na ang loob nila sa isa't-isa

42. Les hôpitaux peuvent être des endroits stressants pour les patients et leur famille.

43. Sampai jumpa nanti. - See you later.

44. Marami ang pumupunta sa Boracay tuwing

45. If you are self-publishing, you will need to choose a platform to sell your book, such as Amazon Kindle Direct Publishing or Barnes & Noble Press

46. This house is for sale.

47. Ang ibig Sabihin ng morena ay hindi maitim hindi maputi

48. Maari mo ba akong iguhit?

49. Naglahad ng mga hindi inaasahang pangyayari ang kabanata, na nagdulot ng tensyon at kawalan ng tiwala sa pagitan ng mga karakter.

50. Habang nagluluto, nabigla siya nang biglang kumulo at sumabog ang kawali.

Recent Searches

interests,befolkningenpalantandaanhumihingirespektivemapuputihiramkilayngitinobodysandwichmaibabalikundeniablehitiklilysiganagpabayadmaulitorugamalakinasasakupannanamanalexandertressagingahhhhevening10thpalaginananaginippagpasensyahanworkdaygagawinsang-ayonpinakamagalingpinabayaanmagingmakipag-barkadamakatarunganglolanangangaraltumakasnaglokohannagtungoiiwasanbihirangbahagyapinaggagagawangayonniyofollowednapaluhaipinangangakvitaminnapadaanspellingnakapikitiyakperseverance,diversidadiskedyulamendmentsbumigaydomingoreservationmatitigasofrecenletteragadnagmadaliipapaputolmakasarilingboholtwitchbigotemakisuyonagpasannilaosnagbungacardopgaver,following,mahiwagangbumahatawadbroughthigantebeingpaypilingnaiinggitpersonsnapasukopayongnakapagreklamoydelsermassachusettsmakalipastaga-ochandopinalambotpagdamihabitasiakaraniwangbinigyangvelfungerendeisinumpalikurantuladbuwayatools,artistasbinawiorderinnoble1973pasalamatanlibagprosperhatingpocasubjectimaginginaantayuseconstitutionadecuadoattackconvertingmaximizingpagkatpumayagnakalipasvideos,luluwasiwanpasensiyapinapanoodphilanthropysiyang-siyanagtalagaseryosonggandapambahaywingpinangalanantirangmaluwagkalabawmasukolkoryentebookssipagdiaperkumakantalawadeterminasyonkumukulotamissinesalbahekanangimportantatentomaalogencompassesconvertidasboxmayreportsimulascaleginangkagalakankaninongkuwadernohumiwalaypaghaliktagaytaynakatagonakakapamasyalbakanteumigtad18thvedvarendewatchherramientasnakangisinggovernorsteachingsmagdugtongpnilitdelemagdaanbarangayreviewtomorrowsalatablebinuksan